GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:01:41

Sequence IL1F7_1 : 8308 bp : 48.70% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1276   1324   49  0  1   78  116    22 0.559   5.11
cagagcaaggccagtggtctgttcagcactagagacatgcagcaaggtgtcctggggtga
gaagatgccataactggtcccctttctatctccttaggtcttggacttcattccattttc
tgttgagtaataaactcaacgttgaaaatgtcctttgtgggggagaactcaggagtgaaa
ATGGGCTCTGAGGACTGGGAAAAAGATGAACCCCAGTGCTGCTTAGAAG
gtaaggttcttgtagaaatctacctcagggccaaagtgtaattcctagagcagaactttg
ctaggtgctgtgcacagacccagttgtttcctgctgacttgcacagtaagtgagctttca
aatttccctggacaaataactagacaagagaaattctggaagggaaaaggaagctttgct

 1.02 Term +   3162   3364  203  1  2  -15   53   210 0.537   4.75
tctccttgtcagggctgggatctccttcaaatctggcggaagtggttctccaagtctggt
cctcaaacgtcagcagcatcagcgcctagaagtgttaggaatacacattcccaggcccca
ccacagacctcctgcctcagaaactcagggcgctgaggctctaggggctgctttaacaag
ACTTCCAGGTTATCGTGACGCACCTTGAAAGTCTGAGAGCTACTGCCCTACAGAAAGTTA
CTAGTGCCCTAAAGCTGGCGCTGGCACTGATGTTACTGCTGCTGTTGGAGTACAACTTCC
CTATAGAAAACAACTGCCAGCACCTTAAGACCACTCACACCTTCAGAGTGGCCTTGAGAA
AGATTTGGGGTCAAGGATCATGA
gcgagaacaccacttaagaggatagtgaactagtctgcatgtgagacgctgagatcctat
gtcaggctgtgataggagggaaacagaaaccaaaggaaagaacagctttaagaagcgctt
aagaggtacaaagtaaaatgatggtgctagaaaagtagcttcttaaaaagagcattttcc

Predicted peptide sequence(s):


>IL1F7_1|GENSCAN_predicted_peptide_1|83_aa
MGSEDWEKDEPQCCLEDFQVIVTHLESLRATALQKVTSALKLALALMLLLLLEYNFPIEN
NCQHLKTTHTFRVALRKIWGQGS