GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:16:53

Sequence IL18R1_1 : 38521 bp : 40.18% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   8634   8746  113  2  2   65   61    89 0.604   3.64
gaaggaaggggatacaaaagggatagttttcaatgatagagatgaagaaatgaaggtaga
gggaaatgtacacacagaaatctaataaaccaatcctaggctgacaggcagcaagttcag
cttggtgagcagcctcagaagtgggggctggtgtttatcccctggtgtctgtggacaaaa
ATGAGTGGTTTTCATAACCAGGATGGGCTGGGCCTGCAGCAGGAAAGTGTGGTCACAGCT
TTGGGTCAGTTGGCCTCAGTGTTAACCCTAGCCTTGGAGCTCCTGGATGGCAG
gtgcagtgtgttgttgattgtttcagtgttcccagagcagtgtcctgcacatggagtgtc
atcagtcctctagcatttgttgagtgttaggaattgaggattacagaggtagagaacaat
gtagtctgaaaaaatggggatattcatgtaccctattccttttaagcaacaagtcataga

 1.02 Intr +  10517  10682  166  2  1   76   90    36 0.355   1.64
tttttaaagttcttgctcttctgaatcaagcggaggcagagcagggtttgcacatcaatg
aatcaatctctttaataaaaataaaggaaaaatattgtaactggttactaaagggaagat
gggtgatatttgcaaagtttctgtagcattataaaatacctttacacttttattccatag
AAATTATACTCAGAAATGGAAATTAAATGTCATCAGAAGAAATAAACACAGCTGTTTCAC
TGAAAGACAAGTAACTAGTAAAATTGTGGAAGTTAAAAAATTTTTTCAGATAACCTGTGA
AAACAGTTACTATCAAACACTGGTCAACAGCACATCATTGTATAAG
gtaatgcttttataatattttaactttaagacttgatggaaaagataaaattcccaaatg
aggggctgagagctaccattctggtctcataacaaataagctgcctgatcccacatggct
cacttgccctgtttgagccaagtatcctcactggcttgttgtcaagagctgatacatagt

 1.03 Intr +  14471  14627  157  1  1   41  116    88 0.786   5.56
ggatcgcatttaattgtttcagtaaaagtagtaccaagtaactgggacatatgtccagga
attgctactttccattcttttttcctttttctctaaagatctttaactcaaaaatttgga
tcactgtaatatcaatttggcttttacttaaagtattttaacttgttttattaaaaacag
AACTGTAAAAAGCTACTACTGGAGAACAATAAAAACCCAACGATAAAGAAGAACGCCGAG
TTTGAAGATCAGGGGTATTACTCCTGCGTGCATTTCCTTCATCATAATGGAAAACTATTT
AATATCACCAAAACCTTCAATATAACAATAGTGGAAG
gtaagggaaatcttagaattgggaagaaacagacgtattttagtaaaatggaattttttc
attcttcaaaactgtgtaggaattgagagtccacttagttggggttgtgaccacaccact
agttcaaatatgatggtcaaaatcttcattctggtgctcctctacttggctaaataaacc

 1.04 Intr +  23442  23562  121  1  1   19   39   170 0.642   3.83
tgctacctatttcttctgctttatatattttgttttatttaaagcaaggcatatttattc
tctttctgggatggagcaccacgttttgctttaggttaacatacattgattatattgttt
tgaaacttttaagaaacctgagtttcaaaaatcagaactttagttgccaacttttaccag
GAAAAAACGTAAGGCTCAACTGCTCTGCTTTGCTGAATGAAGAGGATGTAATTTATTGGA
TGTTCGGGGAAGAAAATGGATCGGATCCTAATATACATGAAGAGAAAGAAATGAGAATTA
T
gtatgtatgtgtaatatatatgtcatgatatataccatataacaatcatatatattatat
ataacatcatattaaaaacactgggtggctgatgtgtattttgggctagtttaaattata
attataatggacatattttataattatagtggccataccctaggtggacgcattatgcag

 1.05 Intr +  25425  25564  140  0  2  106  100    52 0.911   7.39
ttctgatgctccacggaggaggggacgtttattgtagtccatgctttaagagtactggcc
agaaagggaagaaataatgcaggcaacatcacagctgccttcaagcattttaaacatgtg
aattcccctctcaagggtaacgaacagagcctactgctaaattattttgccctcttacag
GACTCCAGAAGGCAAATGGCATGCTTCAAAAGTATTGAGAATTGAAAATATTGGTGAAAG
CAATCTAAATGTTTTATATAATTGCACTGTGGCCAGCACGGGAGGCACAGACACCAAAAG
CTTCATCTTGGTGAGAAAAG
gtgagaaagatttatttttggaagttttgaaacttagctcattgctactgagagacattt
caaagatggccactttctcattttccacaccagaacccagctcctgagaggggaaatcag
tcacctcatgtcacaggcattcagtggggcccctctgtctcatgatgccaagcagagaat

 1.06 Intr +  28620  28781  162  1  0  110   92    31 0.869   4.73
gaaatatcactactccagactaaaggcaggaatgtggagtcactcagtggaatgtgtcag
cacgtgggttggcaactactgcattagtgttagcagtaaaaatggacaagcacgtgatga
tggacaacactggtaagatttcttgattattttcttttcctttttccctttcttttctag
CAGACATGGCTGATATCCCAGGCCACGTCTTCACAAGAGGAATGATCATAGCTGTTTTGA
TCTTGGTGGCAGTAGTGTGCCTAGTGACTGTGTGTGTCATTTATAGAGTTGACTTGGTTC
TATTTTATAGACATTTAACGAGAAGAGATGAAACATTAACAG
gtaacacatataatgctggaatttcttaccttatgttctcattaagaaatcagataaata
ggcattaatcttcatcttattgtgatgatattgtagaattaatctgtgggagaggttttc
tatgggaaatattgttctgcctgtaccatccattatgaatgttgtctatgtcttcttttc

 1.07 Intr +  33033  33191  159  1  0   46   94   173 0.780  12.74
ttaaaaacacattggctaattggttgcttggttagcatgggaggtttaaatataaacaac
tttatatataatttgttttttcaatgattctatactcattacttacgacattcacttaag
tttgtacttaaataaaattttatttacacatgaattaaaagagccaatcttacctcctag
ATGGAAAAACATATGATGCTTTTGTGTCTTACCTAAAAGAATGCCGACCTGAAAATGGAG
AGGAGCACACCTTTGCTGTGGAGATTTTGCCCAGGGTGTTGGAGAAACATTTTGGGTATA
AGTTATGCATATTTGAAAGGGATGTAGTGCCTGGAGGAG
gtaagagggaatgccagatagaaaaatattcaagatagtttctttttaaaaaatgaatga
gctagcccccagagagctatcccattttccttaaaaacaaatgaataaggtcctttaagc
aagaaataaccacgtaagtcaacaatcgatagtgagaaaacaaactaatgagcttccaat

 1.08 Intr +  35095  35182   88  2  1   68   80    58 0.356   1.11
tattgttacctagagattttttaataagcatataaaattaagaacaaatggtttgtctta
aagaaaaacttattagtgaggttaggagttaatataaaataagactgtgcaaaatgactt
ttatctcatgttccccctttcagttatcttaaattaataggggttatcttgcattttcag
CTGTTGTTGATGAAATCCACTCACTGATAGAGAAAAGCCGAAGACTAATCATTGTCCTAA
GTAAAAGTTATATGTCTAATGAGGTCAG
gtatgaacttgaaagtggactccatgaagcattggtggaaagaaaaattaaaataatctt
aattgaatttacacctgttactgacttcacattcttgccccaatcactaaagcttttgaa
atctcacagagttctgaagtggaaggccgataaatctctttcttataactcaaggttctg

 1.09 Term +  35937  36105  169  0  1   71   42   104 0.316   0.47
tgatgcaaaataaccgatgccctacaaaaagggcgcatctttaagagttttaatgccagt
gcttaattcgaatgaggggattttaagtgtctgaagaggcattttctagggaccagtggg
tgactgagtaactgaaatgctgctttcactccctaacaccatggatctggttgtgcatag
GATGTGGGAGGAGGGGCTGGCAGGGCCGCCTTCAGAGGCTGCAGGGCCTCAGCCTCAGGA
TGCATTTAATGTATCCTGGCCACAGTTGCAGCCAACGGTTCTTGAAAGCTCGGTAAGGCC
CTGCAACGCAGAGCCTGCTTATGTGGATCTATTTATGGGAACTTCTTAA
aaggaccccagaatagctctttatctttcacaagagacacaaattctaattgagttaatt
atctgggcctttcactttggatgctctgaaacatttgttgattttgtgtgaatgtttata
tcaaaatgtttgccaggttgtattagccattgaatagcaaaaaactgatagttacttgct

 2.02 PlyA -  36585  36580    6                               1.05
 2.01 Term -  38090  37835  256  1  1  116   36   110 0.547   2.67

Predicted peptide sequence(s):


>IL18R1_1|GENSCAN_predicted_peptide_1|424_aa
MSGFHNQDGLGLQQESVVTALGQLASVLTLALELLDGRNYTQKWKLNVIRRNKHSCFTER
QVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQGYY
SCVHFLHHNGKLFNITKTFNITIVEGKNVRLNCSALLNEEDVIYWMFGEENGSDPNIHEE
KEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKADMADIPG
HVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYRHLTRRDETLTDGKTYDAFVSYLKE
CRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVVPGGAVVDEIHSLIEKSRRLIIVLS
KSYMSNEVRMWEEGLAGPPSEAAGPQPQDAFNVSWPQLQPTVLESSVRPCNAEPAYVDLF
MGTS

>IL18R1_1|GENSCAN_predicted_peptide_2|85_aa
XASPRQPASPPQAPALGPLSLNCRPQKSACSLQDAHLQEEAVRHPVPTWSDRSCATVTKS
LDLPCLKFLGLEYVGPKASHCFEKI