GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:50:51

Sequence HOXD10_1 : 5326 bp : 50.94% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1389   2112  724  2  1  106   53   567 0.560  49.99
agagatgtcagcctacaaaggacacaatctctcttcttcaaattcttccccaaaatgtcc
tttcccaacagctctcctgctgctaatacttttttagtagattccttgatcagtgcctgc
aggagtgacagtttttattccagcagcgccagcatgtacatgccaccacctagcgcagac
ATGGGGACCTATGGAATGCAAACCTGTGGACTGCTCCCGTCTCTGGCCAAAAGAGAAGTG
AACCACCAAAATATGGGTATGAATGTGCATCCTTATATACCTCAAGTAGACAGTTGGACA
GATCCGAACAGATCTTGTCGAATAGAGCAACCTGTTACACAGCAAGTCCCCACTTGCTCC
TTCACCACCAACATTAAGGAAGAATCCAATTGCTGCATGTATTCTGATAAGCGCAACAAA
CTCATTTCGGCCGAGGTCCCTTCGTACCAGAGGCTGGTCCCTGAGTCTTGTCCCGTTGAG
AACCCTGAGGTTCCCGTCCCTGGATATTTTAGACTGAGTCAGACCTACGCCACCGGGAAA
ACCCAAGAGTACAATAATAGCCCCGAAGGCAGCTCCACTGTCATGCTCCAGCTCAACCCT
CGTGGCGCGGCCAAGCCGCAGCTCTCCGCTGCCCAGCTGCAGATGGAAAAGAAGATGAAC
GAGCCCGTGAGCGGCCAGGAGCCCACCAAAGTCTCCCAGGTGGAGAGCCCCGAGGCCAAA
GGCGGCCTTCCCGAAGAGAGGAGCTGCCTGGCTGAGGTCTCCGTGTCCAGTCCCGAAGTG
CAGGAGAAGGAAAGCAAAGGTCGGTATGAGCAGAGTTGCCACCCCAGCGGGGCGCGCAGC
CCGGGAACCCGGCAGAGAGGGAGTGCCGGGGTGCCCAGCGCCGAGCCGGAGCCCGACTTG
GCAG
gtgctgctccgcctggttttagaggggtgatctcagccctgagatagtccccgcttctcc
cctgctgccctggccctctccgccagtcctggccccacgctgatggcgcccgggcagagg
aaaagcttgccggttttatttttcctgagctagacctgaacacaacaaaagagcgcaaag

 1.02 Intr +   2230   2451  222  2  0   28   65   171 0.850   6.90
cgggaacccggcagagagggagtgccggggtgcccagcgccgagccggagcccgacttgg
caggtgctgctccgcctggttttagaggggtgatctcagccctgagatagtccccgcttc
tcccctgctgccctggccctctccgccagtcctggccccacgctgatggcgcccgggcag
AGGAAAAGCTTGCCGGTTTTATTTTTCCTGAGCTAGACCTGAACACAACAAAAGAGCGCA
AAGGAGACCTGCGGCTCATAAACACGACCACAGAGCCTCTTTTCTCCTGCTCAGATTTGC
AGTTCCAGTTTTGCCTTGAGCCCAATGATCATGTTAAGGTGATCCAGGGCACCGTGTTCG
TGTTCAAGTGTATGCACCCCGCATCCTGCGAGCTTGGGGGTG
gtgaggggaaagagatggctgggctggttggtgcttgagttgggaaacagggcttactgc
ctttgctgggctaggtaaccttggctttgtttaggaaaagtgctgcagtctttgcaatcc
gtcggcaaagagggcaaaggcggagggggagagtggaacccgcattgccctccctgcaag

 1.03 Term +   3383   3660  278  0  2   50   42   244 0.997  11.62
actagcattttccaaagcggcctggctgccagcagggtcacggccaagggtacatttgaa
cagtctgaagaaaaaaacaaaaacgaaaaccaaaaccaaaaccaaaacaaaaacaaaaac
aaaaacaaacaaacaaaaaacctcttgatttttttcttcttctccctttaattttgttag
AGGAAATCAAGTCTGATACACCAACCAGCAATTGGCTCACTGCAAAGAGTGGCAGAAAGA
AGAGGTGCCCTTACACTAAGCACCAAACGCTGGAATTAGAAAAAGAGTTCTTGTTCAATA
TGTACCTCACCCGCGAGCGCCGCCTAGAGATCAGTAAGAGCGTTAACCTCACCGACAGGC
AGGTCAAGATTTGGTTTCAAAACCGCCGAATGAAACTCAAGAAGATGAGCCGAGAGAACC
GGATCCGAGAACTGACCGCCAACCTCACGTTTTCTTAG
gtctgaggccggtctgaggccggtcagaggccaggattggagagggggcaccgcgttcca
gggcccagtgctggaggactgggaaagcggaaacaaaaccttcaccgctctttgtttgtt
gttttgttgtattttgttttcctgctagaatgtgactttggggtcattatgttcgtgctg

Predicted peptide sequence(s):


>HOXD10_1|GENSCAN_predicted_peptide_1|407_aa
MGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCS
FTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGK
TQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAK
GGLPEERSCLAEVSVSSPEVQEKESKGRYEQSCHPSGARSPGTRQRGSAGVPSAEPEPDL
AEEKLAGFIFPELDLNTTKERKGDLRLINTTTEPLFSCSDLQFQFCLEPNDHVKVIQGTV
FVFKCMHPASCELGGEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTR
ERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS