GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:11:26

Sequence HES6_1 : 4160 bp : 65.50% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1325   1405   81  1  0  103   86    83 0.971  10.67
agatgcaaataagcggctataaaaggggcgggaccgcggcgggccggaagccgcgaggag
cgcggacggctgggctgctgctgggcggccgcggggcagcggagggcgccggcactccgg
tccccgccgctccccgtccccgctgctcctagcccctgccgcgtccccggcggagcgggc
ATGGCGCCACCCGCGGCGCCTGGCCGGGACCGTGTGGGCCGTGAGGATGAGGACGGCTGG
GAGACGCGAGGGGACCGCAAG
gtgcgggccggggccatgggcgagcaagcgggcgggaggccgtgcggggctgggattcag
tgccccgctccccgcaggcccggaagcccctggtggagaagaagcggcgcgcgcggatca
acgagagcctgcaggagctgcggctgctgctggcgggcgccgaggtgcggcggccgggca

 1.02 Intr +   1483   1569   87  0  0   92   64   241 0.999  23.42
ccgcgtccccggcggagcgggcatggcgccacccgcggcgcctggccgggaccgtgtggg
ccgtgaggatgaggacggctgggagacgcgaggggaccgcaaggtgcgggccggggccat
gggcgagcaagcgggcgggaggccgtgcggggctgggattcagtgccccgctccccgcag
GCCCGGAAGCCCCTGGTGGAGAAGAAGCGGCGCGCGCGGATCAACGAGAGCCTGCAGGAG
CTGCGGCTGCTGCTGGCGGGCGCCGAG
gtgcggcggccgggcaggcgccgtggggctgcggggcgggcgggcgggtccgggagcgcg
ctgccggctcaccgcccttcccgcccgcgcaggtgcaggccaagctggagaacgccgaag
tgctggagctgacggtgcggcgggtccagggtgtgctgcggggccgggcgcgcggtgagt

 1.03 Intr +   1662   1743   82  2  1   98  101   135 0.988  16.17
ggcccggaagcccctggtggagaagaagcggcgcgcgcggatcaacgagagcctgcagga
gctgcggctgctgctggcgggcgccgaggtgcggcggccgggcaggcgccgtggggctgc
ggggcgggcgggcgggtccgggagcgcgctgccggctcaccgcccttcccgcccgcgcag
GTGCAGGCCAAGCTGGAGAACGCCGAAGTGCTGGAGCTGACGGTGCGGCGGGTCCAGGGT
GTGCTGCGGGGCCGGGCGCGCG
gtgagtggcggcggggcgggcgggggcgccggccgcgggcgcctgtaacccctgccagac
ggaggacttccctcccggcgcccctgtcctgtcggcggcgagggctcccaccggagcagg
gtgcgcccccgcgtctcctgggtgagccgcgtccccgcgggccgggtgggctgggccacg

 1.04 Term +   1979   2403  425  0  2   54   47   541 0.890  43.15
cagacggaggacttccctcccggcgcccctgtcctgtcggcggcgagggctcccaccgga
gcagggtgcgcccccgcgtctcctgggtgagccgcgtccccgcgggccgggtgggctggg
ccacgcagtcgccgctcaccgcgcgggacgcggctctctccctcccaccctcgggcccag
AGCGCGAGCAGCTGCAGGCGGAAGCGAGCGAGCGCTTCGCTGCCGGCTACATCCAGTGCA
TGCACGAGGTGCACACGTTCGTGTCCACGTGCCAGGCCATCGACGCTACCGTCGCTGCCG
AGCTCCTGAACCATCTGCTCGAGTCCATGCCGCTGCGTGAGGGCAGCAGCTTCCAGGATC
TGCTGGGGGACGCCCTGGCGGGGCCACCTAGAGCCCCTGGACGGAGTGGCTGGCCTGCGG
GGGGCGCTCCGGGATCCCCAATACCCAGCCCCCCGGGTCCTGGGGACGACCTGTGCTCCG
ACCTGGAGGAGGCCCCTGAGGCTGAACTGAGTCAGGCTCCTGCTGAGGGGCCCGACTTGG
TGCCCGCAGCCCTGGGCAGCCTGACCACAGCCCAAATTGCCCGGAGTGTCTGGAGGCCTT
GGTGA
ccaatgccagccagagtcctgcgggggtgggcccggccctccctggatctcctccctcct
cccaggggttcagatgtggtggggtagggccctggaagtctcccaggtcttccctccctc
ctctgatggatggcttgcagggcagcccctggtaaccagcccagtcaggccccagccccg

Predicted peptide sequence(s):


>HES6_1|GENSCAN_predicted_peptide_1|224_aa
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD
LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW