GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:53:27

Sequence HDLBP_1 : 41726 bp : 49.33% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1201   1265   65  1  2   79  119    15 0.642   2.06
tcaagctaacgttttttttttcttccaagaaacttgcctgagtattggtgttagtaacca
aagcataaatatcttgaccttttctgattttgaggtaaaaagatctgagttgtaaaatgt
agataagtaacttttctctggtttcctctctctcctctcccacttcccatcccataccag
CAAAAGCTGGCAGGCTGACAGAGGCGGCCTCAGGACGGACCTTCTGGCTACTGACCGTTT
TGCTG
gtaagtttgaccctgtctgaagacttcctgtccctgggctgtgtgtggacctgggggcgc
agggatgcgtattttcttagtcctgtgtgtaccttctttctttatatcacaccttcaagt
ttctcgtggttcgtcagagatgtctccatagcttcacctcccagcaggaaccatctatag

 1.02 Intr +   5137   5294  158  2  2   20   75   161 0.658   7.73
ctggtgacctcctggggccttttcctatcactatgaattagaagagaggggtggggggag
ttgtccttggagcatttgatggttcttgtttgtctgtttttaagcactaaaacccttaaa
agtgtttttcatgtaatgctaaaagtagtgcttccttttaatctgtgttggctggtccag
TTGCCACTCTAAATTCAGAAGAGGAGAGCGACCCTCCAACCTACAAGGATGCCTTCCCTC
CACTTCCTGAGAAAGCTGCTTGCCTGGAAAGTGCCCAGGAACCCTCTGGAGCCTGGGGGA
ACAAGATCCGACCCATCAAGGCTTCTGTCATCACTCAG
gtagaaacaccattctttcttttaaaaattttatcatgtaacatgtctatgtaaattttt
aaattttttttcttttttttttttttgagacagagtcccgctctgtcgcccaggctggag
tgcagtggtgcgatctcggctcactgcacgctccgcctcccgggttcacgccattctcct

 1.03 Intr +   6816   7031  216  2  0   70   94   186 0.977  16.10
cttgaccttggccctttctccttgtctttcggctgctttatcccagggcttcgagcagtg
cctgtgggcagggtggggctgctttgtgagtggatggtgatgaacacatgttctttactc
cctatctgttggccttcttttaatctcttaacctttccttttttgatcttttttgagcag
GTGTTCCATGTACCCCTGGAGGAGAGAAAATACAAGGATATGAACCAGTTTGGAGAAGGT
GAACAAGCAAAAATCTGCCTTGAGATCATGCAGAGAACTGGTGCTCACTTGGAGCTGTCT
TTGGCCAAAGACCAAGGCCTCTCCATCATGGTGTCAGGAAAGCTGGATGCTGTCATGAAA
GCTCGGAAGGACATTGTTGCTAGACTGCAGACTCAG
gtgggtagcctgaggcctacttctccccagtgactgtgtacccgttccattacccggctc
ctgatgcaggctagaacgtcactggacccttcctaccagtgggacagttccgtcttttgg
aggtaggacagcaacattcagagtcctctggcatttttagtggaaaaactcactaaacta

 1.04 Intr +  12936  13142  207  2  0   88   94   241 0.999  23.97
ggagtcagggcaaccttccccaagcatgtgatgtttaagctcatgctgttttaatggatg
agttggtgctgctgggcaggaataagcaaagatggtgtttctgccagaatgtcttggaaa
aatatgctccttcagaacctacaaatattcttgttttcttttattctcttcttgctatag
GCCTCAGCAACTGTTGCCATTCCCAAAGAACACCATCGCTTTGTTATTGGCAAAAATGGA
GAGAAACTGCAAGACTTGGAGCTAAAAACTGCAACCAAAATCCAGATCCCACGCCCAGAT
GACCCCAGCAATCAGATCAAGATCACTGGCACCAAAGAGGGCATCGAGAAAGCTCGCCAT
GAAGTCTTACTCATCTCTGCCGAGCAG
gtgaggcctgtgtgagtgcctcgtgcccctgcctacctgcttgtgcagacctcactccct
catgggttgccgtgtccagtgtggacttcaaggcataatgtggtgggggtggagggcttg
actccaactctaaaaagccctgtctgtccccagtttgttttcaaaggcctgttctcatca

 1.05 Intr +  13343  13558  216  1  0  107   81   305 0.999  30.40
tcgtgcccctgcctacctgcttgtgcagacctcactccctcatgggttgccgtgtccagt
gtggacttcaaggcataatgtggtgggggtggagggcttgactccaactctaaaaagccc
tgtctgtccccagtttgttttcaaaggcctgttctcatcagatcatcccttcctttccag
GACAAACGTGCTGTGGAGAGGCTAGAAGTAGAAAAGGCATTCCACCCCTTCATCGCTGGG
CCGTATAATAGACTGGTTGGCGAGATCATGCAGGAGACAGGCACGCGCATCAACATCCCC
CCACCCAGCGTGAACCGGACAGAGATTGTCTTCACTGGAGAGAAGGAACAGTTGGCTCAG
GCTGTGGCTCGCATCAAGAAGATTTATGAGGAGAAG
gtacacgatttagaggaggcaaatccccatgggcaggaatagaaatgaggatttgggtct
ggagattcagttaaggcctggttctgccccttatctttttgtccttgatgaagatgctta
ttgtctctacacttgagtgacccgggtgagatcggtgcccgcccccccttgctgttgagc

 1.06 Intr +  14162  14368  207  1  0   80   88   140 0.971  12.47
cagtccttgaacagtgaagtttctggggattggctagtcctgatcacttgttgttcactt
cttgggatcagcatctatagtctgggccgctttggcttgctttctgcagcagtggccatg
cccacctgcccgcttcccacacctttccctttgactgccccttatggtgctcttatttag
AAAAAGAAGACTACAACCATTGCAGTGGAAGTGAAGAAATCCCAACACAAGTATGTCATT
GGGCCCAAGGGCAATTCATTGCAGGAGATCCTTGAGAGAACTGGAGTTTCCGTTGAGATC
CCACCCTCAGACAGCATCTCTGAGACTGTAATACTTCGAGGCGAACCTGAAAAGTTAGGT
CAGGCGTTGACTGAAGTCTATGCCAAG
gtaactgcctccgagcatgaagtgtgtctcctttgagtggagtccgcggggccttcatgg
atgagctctcgatttgtaaatcctggggcctggacacagtgcaggtgcccaggtttgggg
agagcgtgcctctgagccccaggtgagcagcctggctttcactgtgacacgaccttgagc

 1.07 Intr +  14584  14691  108  0  0   78  116    79 0.999  10.18
agtggagtccgcggggccttcatggatgagctctcgatttgtaaatcctggggcctggac
acagtgcaggtgcccaggtttggggagagcgtgcctctgagccccaggtgagcagcctgg
ctttcactgtgacacgaccttgagctctgcaaacccatggctgttctcccattttcttag
GCCAATAGCTTCACCGTCTCCTCTGTCGCCGCCCCTTCCTGGCTTCACCGTTTCATCATT
GGCAAGAAAGGGCAGAACCTGGCCAAAATCACTCAGCAGATGCCAAAG
gtaaggacacgtttttcacctgttgtattgaatttgtcttgttttctgtctttctgtttc
tgatattgctttgttgacctttgtactgtggatgcccttgaaaactggtgtatttttctg
aattaactggcctgtttgacatggtcaacttccgtgttagcttaaagaacagcagaataa

 1.08 Intr +  16245  16349  105  2  0   45   87   184 0.998  14.41
tggctccctaaccctccctttcaactttgtttgatggctgtggatatgtccctccctccc
tcacatctatgtgaagcagtttgggatcagaagccgctccgaagagagctcccactggga
gctcaggggctgcagctgtgccattctgttttagctatctctttggttttggtgtggtag
GTTCACATCGAGTTCACAGAGGGCGAAGACAAGATCACCCTGGAGGGCCCTACAGAGGAT
GTCAATGTGGCCCAGGAACAGATAGAAGGCATGGTCAAAGATTTG
gtaaggtaccccttggaatgttgtgtgtgctggtgacaagggaggctctgagttgggcat
gggcggtcatctctcgatgacatcccacatgtccgggcacagacacccagggcatcctag
ctgggtgagtaataggttctgaaacaaccagaagctggtcgaagtcctggaataatcgtg

 1.09 Intr +  16707  16785   79  2  1   71   79   176 0.985  14.12
gtgggtggaggaaacttcatcttgaagaaggcatctttcaggggagatgcaggggcagtc
tccaacaattcctgacagctgagtggtcagaaaaggcaaccgtggagactgctgggtttt
ggttcagctcattggccaagtaaccaggcgcatccatggacctctgtgctcctcctgcag
ATTAACCGGATGGACTATGTGGAGATCAACATCGACCACAAGTTCCACAGGCACCTCATT
GGGAAGAGCGGTGCCAACA
gtgagtgaggctgtctgttgcggtggggccagtgtgccctgagacccttgtggggggtgt
cagctgtgagaactgtgacgtccgtgcagacagtccaggcccattgctgcctgtaatggg
agttacagactttacatcctcctgcctgctggaagaggccacttttccttttccctttgg

 1.10 Intr +  19762  19901  140  2  2   70  115   226 0.999  23.68
atcataactggcccccattctagacaatggagatttttgtttgggaagctaagcatcgtt
tttggtgatgggaatcacagataaggttatttagcgctttagcgctgtcctgcccagtta
tgtcattggcagaatgttgttggtctgtgtcctaaatgtgtttccttttgtgttcctaag
TAAACAGAATCAAAGACCAGTACAAGGTGTCCGTGCGCATCCCTCCTGACAGTGAGAAGA
GCAATTTGATCCGCATCGAGGGGGACCCACAGGGCGTGCAGCAGGCCAAGCGAGAGCTGC
TGGAGCTTGCATCTCGCATG
gtaagtgccatggctgggccctctagaaaggcactggccttgcgtctcttggccccctct
aaggagtagcgtgttgtggtgtgcggccttagagaatggaagtcgacaaatcccacgttg
cactggaaccggattggactccctggggccacatttcctttatcctccccaggtcacctg

 1.11 Intr +  21394  21498  105  0  0   91   88   165 0.999  17.21
atgcgctgtgcacactcttaacagctggttgctcccggggtgctacgaggtgccacctgg
agaccacctcacctgctccatgaaggactgtgcccagggctccctggtgtccccttgtgt
cagtggggagttgctcgccgtgcttgtgataaatgacatctactttaattgtatttttag
GAAAATGAGCGTACCAAGGATCTAATCATTGAGCAAAGATTTCATCGCACAATCATTGGG
CAGAAGGGTGAACGGATCCGTGAAATTCGTGACAAATTCCCAGAG
gtaaagtttcccagagacattctgtaactctataggagtgatccaagtcacacttcagga
atatttgatatttgggatatatgtccttcctcatacttgaacttagtctccccatgattt
gttctaggtcatcattaactttccagacccagcacaaaaaagtgacattgtccagctcag

 1.12 Intr +  21626  21739  114  1  0   89   58    45 0.792   2.24
tcattgggcagaagggtgaacggatccgtgaaattcgtgacaaattcccagaggtaaagt
ttcccagagacattctgtaactctataggagtgatccaagtcacacttcaggaatatttg
atatttgggatatatgtccttcctcatacttgaacttagtctccccatgatttgttctag
GTCATCATTAACTTTCCAGACCCAGCACAAAAAAGTGACATTGTCCAGCTCAGAGGACCT
AAGAATGAGGTGGAAAAATGCACAAAATACATGCAGAAGATGGTGGCAGATCTG
gtaggggtgtttcacatcctttcttgtatgacagcacctggggtgggtggggcatgcgtc
ctgtcagaagtcctgacccccacaggacccctgctctggggaaagcacataggccctggg
ctggccttccatctcagggacttgggacaaagtggtgacggcttctcacttaatacctgg

 1.13 Intr +  22859  22990  132  1  0   99   55   142 0.974  12.84
ttaaaaaggtgataacttgtccgctgcatcttgcttcttcttgccttgtcctctgtagcc
ctgcaccattttggttttagactaggagggactcttccttacttctagccctgtgctcaa
ctgtgtctcaactctgggagagctctagtcagcttctcatggtgatctctctccctgtag
ATTCGTGAAGAAAGCAACACCAAAATCGACCTTCCAGCAGAGAATAGCAATTCAGAGACC
ATTATCATCACAGGCAAGCGAGCCAACTGCGAAGCTGCCCGGAGCAGGATTCTGTCTATT
CAGAAAGACCTG
gtaatgggagatgttttctaatggagatcctccagtaaaatctctaacagcctctaagat
tgagcctggggttgagtcacgcagggtcattgggccagcgcaggctgatgtggaagattg
cacctttcaatccaggctactgatgagttggtcagcagttttctgcctttgtctctcacg

 1.14 Intr +  27064  27282  219  0  0  111  105   312 0.997  33.70
ctctcctcccccgtgcaggtcaaaaatggcttggagaagtttggtcagtgcttgtaagtg
gcatctccagggctctaggcctgcgtgttcatcaccaccaaagatgatagtttatctttt
cctctgccctttttgccacaaaaatgtgacttcctcctcctgccctgtgtttggtttcag
GCCAACATAGCCGAGGTAGAGGTCTCCATCCCTGCCAAGCTGCACAACTCCCTCATTGGC
ACCAAGGGCCGTCTGATCCGCTCCATCATGGAGGAGTGCGGCGGGGTCCACATTCACTTT
CCCGTGGAAGGTTCAGGAAGCGACACCGTTGTTATCAGGGGCCCTTCCTCGGATGTGGAG
AAGGCCAAGAAGCAGCTCCTGCATCTGGCGGAGGAGAAG
gtgagcatggggagggagcgtgactcttggcaggaagcctggtcctcagtacagtgttct
cgcttctcactgtggaaacccctgaatgcccttcctttgtggcgggtcagaaaacagctc
tataatgtactgtttatgcgtctttgtttttgctgttactggagggcctttccaggtcca

 1.15 Intr +  29620  29841  222  0  0   42   58   450 0.545  35.72
tattcatctgtttattcagtgaggtgtgctagccccattttgggggtattggtgcaacat
caggacactggtgacaatgtaaggggagcccgagcttgctgtcctacagaccctcttgtc
ttcctcactgtggtccaggcacgtggtgtcaggctaacacagtgggattggtttctgcag
CAAACCAAGAGTTTCACTGTTGACATCCGCGCCAAGCCAGAATACCACAAATTCCTCATC
GGCAAGGGGGGCGGCAAAATTCGCAAGGTGCGCGACAGCACTGGAGCACGTGTCATCTTC
CCTGCGGCTGAGGACAAGGACCAGGACCTGATCACCATCATTGGAAAGGAGGACGCCGTC
CGAGAGGCACAGAAGGAGCTGGAGGCCTTGATCCAAAACCTG
gtagggagcgggcctcggcggccgactctgctggggccgtgatggggtggcttatcttcc
atctcttcttaacactgcaggataatgtggtggaagactccatgctggtggaccccaagc
accaccgccacttcgtcatccgcagaggccaggtcttgcgggagattgctgaagagtatg

 1.16 Intr +  29922  30140  219  2  0   77   70   393 0.990  34.90
tgcggctgaggacaaggaccaggacctgatcaccatcattggaaaggaggacgccgtccg
agaggcacagaaggagctggaggccttgatccaaaacctggtagggagcgggcctcggcg
gccgactctgctggggccgtgatggggtggcttatcttccatctcttcttaacactgcag
GATAATGTGGTGGAAGACTCCATGCTGGTGGACCCCAAGCACCACCGCCACTTCGTCATC
CGCAGAGGCCAGGTCTTGCGGGAGATTGCTGAAGAGTATGGCGGGGTGATGGTCAGCTTC
CCACGCTCTGGCACACAGAGCGACAAAGTCACCCTCAAGGGCGCCAAGGACTGTGTGGAG
GCAGCCAAGAAACGCATTCAGGAGATCATTGAGGACCTG
gtaggcacttgggtgctcggggaggggttctcaccccccagtggccactcaccgaagccg
tgtatgagtgttcgctccaccctgtagggaggtgactccctcatacagccctggaaggct
tcagaaggggctttctggtgctcgctcttctttcctcagcctgtctggcctccttcctga

 1.17 Intr +  30955  31093  139  0  1  109   94    56 0.996   8.34
gacctgtcctgctacctccctcctccctgcgcctggagccctggactcgggagaagggga
gcatctgtgccaagtggctgtagaggacagggaggaaggtggtgtgaagagtgctgtaaa
acttgccctaaggaatttaatctttgctcttttcttttttctttgtgtacctccctccag
GAAGCTCAGGTGACATTAGAATGTGCTATACCCCAGAAATTCCATCGATCTGTCATGGGC
CCCAAAGGTTCCAGAATCCAGCAGATTACTCGGGATTTCAGTGTTCAAATTAAATTCCCA
GACAGAGAGGAGAACGCAG
gtgggtcccccattagccctgctctgcttgttaatagtggcgcctcccatgtgagaggcg
gggctgtcgcacatactggtgaggctctttcctgtctctgctggaaaaccatctatgtat
tctgggggcttccagaggttcagggtcactccctggcctttaaaagatggaccacgtcag

 1.18 Intr +  32973  33127  155  1  2  112   87   116 0.991  13.69
tgtggggacgtcctatctgctctccctgaccagaccaagacctcctgaaggacaggagtg
gttttccctcccttttaccacccagcacccagcaggtgcctcacagacatatgcattctg
aacaaggtgtggggtctcttccagcagctgtcagctgtcccttttcccctttctctctag
TTCACAGTACAGAGCCAGTTGTCCAGGAGAATGGGGACGAAGCTGGGGAGGGGAGAGAGG
CTAAAGATTGTGACCCCGGCTCTCCAAGGAGGTGTGACATCATCATCATCTCTGGCCGGA
AAGAAAAGTGTGAGGCTGCCAAGGAAGCTCTGGAG
gtatgtgtccatgtgcccccctccaccccccgccaaggcccagtcagcaggcacctgggg
agacgcgtggcctggatgggatggacggttgcccaagcggcagtggcagtggaggtagcc
ctcttgctcctaccgtgtgcgcacgggctgtgcttctcggctggacacagagtttgggga

 1.19 Intr +  34148  34252  105  1  0  113   59   169 0.999  16.91
atgcaaatcttttcctattcttttctattgagttaaaggtcctggtggcattgtcgggtg
gggcacattgctgttgtcatagggctgtttgccttgtgtttcgtggagccccattgctga
gcttacaacgtcactctgctctcagctcccacggcctaaccatgaccatcctccctgcag
GCATTGGTTCCTGTCACCATTGAAGTAGAGGTGCCCTTTGACCTTCACCGTTACGTTATT
GGGCAGAAAGGAAGTGGGATCCGCAAGATGATGGATGAGTTTGAG
gtagacccctttcccgggaggccatgtcacaggagtggcctgtcgcatcctctcccgagt
gccagtgtcctttctcaacttcctgttgactctgcctcctcctgctcggactgggcactg
acttcccttcacggcgggtggccttccctctcaccacttctgggtcccagggccaatgga

 1.20 Intr +  34487  34621  135  1  0   74   88   218 0.999  21.16
ccgagtgccagtgtcctttctcaacttcctgttgactctgcctcctcctgctcggactgg
gcactgacttcccttcacggcgggtggccttccctctcaccacttctgggtcccagggcc
aatggactctttcctgttctctggggtcctgaacgtcaagtcagccccctcttcacgtag
GTGAACATACATGTCCCGGCACCTGAGCTGCAGTCTGACATCATCGCCATCACGGGCCTC
GCTGCAAATTTGGACCGGGCCAAGGCTGGACTGCTGGAGCGTGTGAAGGAGCTACAGGCC
GAGCAGGAGGACCGG
gtgagcaggaggtggccggggcactgcccagagccatggtgctcagctttgggcacatgt
cagaatctagggaagttcttcaggatcccagcatcccagcgacatctggctggaggtgag
atgcaggcagtgccaggacgcagtcagcatccaggggtcttgctgtggaactagccaaga

 1.21 Intr +  35779  35922  144  0  0  114   94   145 0.998  18.18
attattagcagataatggaaggtggcagaggtcggaccagagagatggcggaccattccg
gaccacgggttacagaacactgcagcatctccagtgtcctatgaccagggtggaagggga
atggagtcacagggtggatcagctcaatctttgcctcattcttgctcctttcatttgtag
GCTTTAAGGAGTTTTAAGCTGAGTGTCACTGTAGACCCCAAATACCATCCCAAGATTATC
GGGAGAAAGGGGGCAGTAATTACCCAAATCCGGTTGGAGCATGACGTGAACATCCAGTTT
CCTGATAAGGACGATGGGAACCAG
gtgagagcctcggttggagcgtgtcgggggcagaggtgcttgttgacctttcctgtgact
tgggagcagtaaccagatgtgcctagatgggggttcgagggccaagttgagagtggcaag
tctctcaggacctaattctggcttgaggtttgggctgtgtctcggtacttgccagatggg

 1.22 Intr +  38798  38983  186  1  0   97  105   298 0.703  32.29
gcgtgagccaccgtgcccggccctgagtggacattgttaacctcttgttttaaatcagcc
gtgacgttgctttccatcttctctcctgagctgttttcctcagcagtgggggccggctct
tgcccctgacgggaatcccagtaaggcatccccttttctgactacattctccttttttag
CCCCAGGACCAAATTACCATCACAGGGTACGAAAAGAACACAGAAGCTGCCAGGGATGCT
ATACTGAGAATTGTGGGTGAACTTGAGCAGATGGTTTCTGAGGACGTCCCGCTGGACCAC
CGCGTTCACGCCCGCATCATTGGTGCCCGCGGCAAAGCCATTCGCAAAATCATGGACGAA
TTCAAG
gtgagccggctggaagcacagtgggtgagaatcctctctcaccgggggcacctggctggc
cagaagaaagagcagggcatggccttcccctcaagatgatgaggccacaaccccagggct
ggcagtggaactgtcctcatggacaccacgggtcagtgcaggcgacggcctgtgtgaggc

 1.23 Intr +  39473  39589  117  1  0  101   83   219 0.883  23.36
gtgctcctgagatacacctaacttggtgtggtgatgaggctgactgacttcagaacaact
ctgaaaccagattttaaaacgtttgctaactcagaaaatgcttcactagaaattgacaca
taattttaacccttttcctcgcttggagtcccctcatctgacgttgtacaccccttccag
GTGGACATTCGCTTCCCACAGAGCGGAGCCCCAGACCCCAACTGCGTCACTGTGACGGGG
CTCCCAGAGAATGTGGAGGAAGCCATCGACCACATCCTCAATCTGGAGGAGGAATAC
gtgagtctctgtgggccttggagccctgaggcgccctggcacgtccaccggcctgaggcc
cagccaggagcttcaggggacaaggtggcacttgtgtttccagaggcaggcgaggtgcag
gggtgagcaggcgggcgggatgctgggggtgctgggcagactgaccctgtcttcctgtct

 1.24 Intr +  39781  39909  129  0  0  139   77   160 0.962  20.89
tgggccttggagccctgaggcgccctggcacgtccaccggcctgaggcccagccaggagc
ttcaggggacaaggtggcacttgtgtttccagaggcaggcgaggtgcaggggtgagcagg
cgggcgggatgctgggggtgctgggcagactgaccctgtcttcctgtcttctgcctgcag
CTAGCTGACGTGGTGGACAGTGAGGCGCTGCAGGTATACATGAAACCCCCAGCACACGAA
GAGGCCAAGGCACCTTCCAGAGGCTTTGTGGTGCGGGACGCACCCTGGACCGCCAGCAGC
AGTGAGAAG
gtcagatgcgggcttctgccctcctgggtcccagggagggtgggcgggcaggcgggcttg
gtgtcctgagggtggcaactgcgtcggaagctgcttgcgagttggggagcatcccctcct
gaagccgtgtcctctctctgcacaggctcctgacatgagcagctctgaggaatttcccag

Predicted peptide sequence(s):


>HDLBP_1|GENSCAN_predicted_peptide_1|1208_aa
XKSWQADRGGLRTDLLATDRFAVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEPSGA
WGNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQ
GLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATK
IQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNR
LVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVK
KSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANS
FTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQ
IEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRI
EGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIIN
FPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLIREESNTKIDLPAENSNSETIIITGK
RANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPV
EGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRK
VRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHH
RHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEA
QVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDREENAVHSTEPVVQENGDEAG
EGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQKG
SGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRS
FKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEA
ARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPN
CVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEEAKAPSRGFVVRDAP
WTASSSEK