GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:34:28

Sequence GCA_1 : 19379 bp : 34.13% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1259   1336   78  1  0   86   84   174 0.964  15.63
ggggcggactgcagctgagttggctccaaagtgtgggactcagccaatcggaaccgtgca
gggcggggctggcctgcggaagggggcgggttcggaggagtgaactgtgcggttagtgcg
cctttcagcctcacctgcagctgcgcctccttgcacctgcgcctgtgctttttctcccag
CACTGCGGACGCGACTCGAGGGTGACGCTCGCTCCGCTCGTCCCGCTCGTCATGGCCTAC
CCGGGATACGGAGGAGGG
gtgagtcccagccgcttggtcgtgtccctcttcctcgcggggtgtggcgcccccgggggc
ggtgccaacgtgcgggtccgcccttggctcctgctccctgcgtccgcgcctggtactcgg
cggcgccggattccggggctgttgggggccagggcctgggcgagcattgatcctgggctg

 1.02 Intr +   2094   2375  282  2  0    8   77   143 0.470   1.89
tggctagccccttcttttcagaaaggagcccaaacctttagtatcgatgtcagtgatcta
cacgctgtgttaacagagttaacagtagtttgatccattgcggtgtgggtagaatataat
atattttctatttgttttttacctaaaaagagaaattgtgttttactgattttaatatag
GACTTGACTTTGGGCTATGGTTGTGGTCTTCAAAAGAGTTACTCCTACCCCTTGGAGTTC
ATGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTGGTTGTGGTTGTGGTTGTT
GTTGTTGTTTTAGGATATGAATTTCCAGGTCCTCAACTTCCACACATACTTGTTCCTAAA
ATTGATTTGCTTTCCTTAAGACTTGCCTCAATCCCCTCTGGCACCGTCCACTTTGTAATG
CCTATGCCTCCTCAGTCCTTAAATTTAGGAAGGAAGTTTAAG
gtacctaaggaaagtaaagccccttcgaagattaatcaagatagcataaacctgtgggtc
tttaaaaacgtccctagcgtatacgtattttcatttggttgaagctatctgttagaagtt
tgtatatttactcctcttggtatgctctgaattcatatatgtatggtagagtgaggtggc

 1.03 Intr +   4639   4803  165  0  0   74   94   135 0.932  11.94
ttgaattatgtcttaatgtaggacatctaacattttgtagttaaaatttttgtgataaga
ttataagcttttggtaactgtttactttttgacggacttctaataatttcttttaatcca
actttcatagataataggtagtatttatattactaaccttctcccctttcactattatag
TTTGGAAATTTTAGCATTCAGGTGCCAGGAATGCAGATGGGACAGCCAGTGCCAGAAACA
GGCCCAGCTATACTCCTCGATGGATACTCTGGGCCAGCATATTCAGACACTTATTCCTCA
GCTGGTGACTCCGTGTATACTTACTTCAGTGCTGTTGCTGGACAG
gtgagatgctaaatttattgcataaatatgtctttaaaattattgtttaagagaaatgtc
agctatttagagtatcattttaaatgtatatgaaatttatattttatatgtatctagact
aatttttttcctgagatcagagatgagcatagtcataattatttcattttaaaagtctgt

 1.04 Intr +  13819  13966  148  0  1  -13   86   146 0.026   3.19
tgaatttaaaaatactttgtaagatcctgtttaaattctaggctttctagtttttatgca
gaagtctgttcatataatgagtttggctaagtctacagaagcatactcatgttttagtca
atgatttagagtcagataaactcaggtatcagaatttatttttgttaataaaactatcag
AGAGATCACACAGGAAAAATGGGATTTAATGCATTCAAAGAGCTATGGGCAGCTCTTAAT
GCCTGGAAGGAAAACTTCATGACTGTTGATCAAGATGGAAGTGGCACAGTAGAACATCAT
GAGTTGCGTCAAGCCATTGGTCTTATGG
gtaagaacattaacattctttagaatctataaagctaatctttgttctttgattagatga
acttaattgcttcaatttactaactaataaagggatgtatttttttgccagcaagttcct
ttgtttgttttcaaggttgtaggtaaattctgaccaaagacctcaacaaaaccattttaa

 1.05 Intr +  16105  16218  114  2  0   58   72    54 0.250   0.30
cgattaacaggattaacagtgaagcctttgtctgatgaatttcaatattcatgtgttttg
tttctaattatatttttgtggaatgaattttgaaagttattttatgacttaatgagaaag
caatcttgcagtgttcttatgttatttacatttagaagttttaatttatctcttttttag
GTTATAGGTTGAGTCCTCAAACATTAACTACTATTGTTAAACGTTATAGCAAGAATGGCA
GAATTTTCTTTGATGATTATGTTGCTTGCTGTGTGAAGCTTCGAGCATTGACAG
gtattgactatttaaaactaagtgcacagtgttatgtagctatttttcttgaataatgtg
tctcatttcctccagcaagtttataataatatgtgttttctccctttattcactgttaaa
tctaattagtttaaaggcttcaaatattaaggaatataaatgataaaaacgttatgttat

Predicted peptide sequence(s):


>GCA_1|GENSCAN_predicted_peptide_1|263_aa
HCGRDSRVTLAPLVPLVMAYPGYGGGDLTLGYGCGLQKSYSYPLEFMVVVVVVVVVVVVV
VVVVVVVVVLGYEFPGPQLPHILVPKIDLLSLRLASIPSGTVHFVMPMPPQSLNLGRKFK
FGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQRDHTG
KMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRY
SKNGRIFFDDYVACCVKLRALTX