GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:42:27

Sequence GAD1_1 : 46977 bp : 45.64% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   2204   2409  206  1  2   52   48   118 0.429   2.20
ggcagcagcagccgaaggcgctactaggaacggtaacctgttacttttccaggggccgta
gtcgacccgctgcccgagttgctgtgcgactgcgcgcgcggggctaggagtgaggtcgga
gggagggtgtggaggcgatggccggtgggcccttctctgtggggtcctcgatctacccag
ATTAGCCCGCAATCTCTCTGTCCCGGGGCCTTCGGGCGCCATCGCGCCAGCGCCGAGAGT
CGAGCAGGGGCGCCGCGCAAGATCTTTGTCCGCCGCCTCCTGCGCGCTGCGCGCAAGTTC
GTTTCCCCGGTGACGTTCCCCATGCTTACTTACCCCACCCTCTCTGGATCTGTACCGCGA
GAAATCTGGGGTCCTCAGGGGGCTAG
gtagaggagaaacgctgaaaccggaccgaaacctcgccctaggcttagcgatggctaaaa
accggctgggataagagggaggcaagcaacattccgactcgctgctttctggctgtctgg
agtgcaaggtgactgtggttcttctctggccaagtccgagggagaacgtaaagatatggg

 1.02 Intr +   2910   3115  206  0  2   96   70    89 0.475   6.74
ccgctggcccacacgccggctgctgagtgcccaatggggcttgtagcggctcggctggaa
aatcgctcactgagcgctcccctgtgctcctagcctagtcccccacacccttgcgtcttg
tactggccttggacccccaccccgaccccgaccccgcctcgtctcggcgcttcactccag
GTCGCGCCGATGCACCGCCAGACTCGAGAGCGGCCCAGGGCTACGCTCCCTGCGCCCCAG
TACCGGAGCTAGCGCGCACGTCTCCTCCGCTGCCCCCACCCCTGCGCACCCCTACCAGGC
AGGCTCGCTGCCTTTCCTCCCTCTTGTCTCTCCAGAGCCGGATCTTCAAGGGGAGCCTCC
GTGCCCCCGGCTGCTCAGTCCCTCCG
gtgtgcaggaccccggaagtcctccccgcacagctctcgcttctctttgcagcctgtttc
tgcgccggaccagtcgaggactctggacagtagaggccccgggacgaccgagctgatggc
gtcttcgaccccatcttcgtccgcaacctcctcgaacgcgggagcggaccccaataccac

 1.03 Intr +   3124   3312  189  2  0   81   58   105 0.507   6.36
ccagggctacgctccctgcgccccagtaccggagctagcgcgcacgtctcctccgctgcc
cccacccctgcgcacccctaccaggcaggctcgctgcctttcctccctcttgtctctcca
gagccggatcttcaaggggagcctccgtgcccccggctgctcagtccctccggtgtgcag
GACCCCGGAAGTCCTCCCCGCACAGCTCTCGCTTCTCTTTGCAGCCTGTTTCTGCGCCGG
ACCAGTCGAGGACTCTGGACAGTAGAGGCCCCGGGACGACCGAGCTGATGGCGTCTTCGA
CCCCATCTTCGTCCGCAACCTCCTCGAACGCGGGAGCGGACCCCAATACCACTAACCTGC
GCCCCACAA
gtaggtcccgccccaattttctatcaaatgaactgcagggaagatgggggcgctgggacg
tcgggaggctgagctggcggaaagggaagggggagcgcggagataatggaggctgggaaa
taaatggggctctgaccccgtccctgccagaggtcattcggctgtcagggacgctaggtg

 1.04 Intr +   5706   5775   70  1  1   90   98    73 0.951   6.74
gatgagatgatgttgaaagtgaaagcactttatcaggtccaaatagctctttatccgcca
ggtattattagggtttcgcttttgcactgatttcctgtctgtcactggaactccatctgt
gacatgtcttaccgacgtcaggctgtttcttctccccgctggggctctgttgtgcctcag
GTTTAATGGATGTCACTCTCCTTATCGCCTCCAACACCTGTGCGAAGCTGGAGGCACCAG
TCAGGGTAGG
gtaagcgagtgcttggagaggtttgctttgagagattggaaggggatttcgtgctgggct
caccacaccactccgcttgggggcttagtggggatggggctgcttcccacgcttcttgct
ggaagttgaaccccgaaggcagcaggtagaccttgaggggtttgagaacagcctggaaaa

 1.05 Intr +   6726   6788   63  0  0  120  115    52 0.964   8.93
ggcttagagtatatgcctgtcggctcacagatttggctcctagctcctttcaggaagtag
cttttaatgaagagctctggcaaagtcctcatcctcccccaagaaaaccattgtcctcca
cccatttccccgcggtcggaacctccctaaccgaacctctctccctctctctcgtcctag
CGTACGATACCTGGTGCGGCGTGGCCCATGGATGCACCAGAAAACTGGGGCTCAAGATCT
GCG
gtaagtgacaggacccactggggcccggctgggtggcgcggcgggcggacctttggggct
tgggagactgggacgcaagcggagggggatccgggctcatgggtctgattttctaatgta
attacagccaggacagccagcgaccacgctcccctacaggccctgaccctcctctgcccg

 1.06 Intr +   8348   8447  100  2  1   51   49   111 0.818   3.61
gggagtttggccttctccccagcgcaggacgcccgtggggcaaggccagggctgcatccc
tgtgctggggcagccggcggccgcggatctttgttctataaatagccccgtcccactccc
acccccacctccacccccaccctgccgccattctgggcttaatggcccgtttcgcgccag
GTCCCTTCGGCGGCCGCAGCGCTCGGCTTCTGCAGCCGTCATTGTCATGCAGCCAGCCGG
GCAGGCAGAACTGAGCGAGCCCTGGGCAGCCGAGGACAGG
gtaggggcaggctctgggcgacggctccttaccagcggcgcctggcctgctgagggtggg
gggcagccctcattcacccccatcctgccccctgctgtcccctgctcctctggctgcagg
cgctccacttccgcgggaataaaaggtctaagtgcttcttatggggacatacccgacgag

 1.07 Intr +  13736  13838  103  1  1   92   68    36 0.672   1.75
cctcacccctcctcatctctctgctgtcctcacctctcctccctctgctatcctcatctt
cctccctcagctgtcctcacctctcctcctccctctgctgtcctcaccctcctccctcag
ctgtcctcacctctcctcctacctctgctgttctctcccctcctccttctgcttatacag
CCCATAAACAGTGCTGGCAGCATCTTCTCTGATTGTGTCTCCTCCTTTAAAGCCCTATCC
TGGGGCTGGTCACTGGAGTGGAAGCTGTCCAACTTACTTAATT
gtgagttcactgtcacattcagagaggagaacgggcttcacttactgtttttctctcttg
catgactgggcctctgccactgatgacatttggcactgcccccctccctgcctgaaggcg
agcagtgccagagccactgtatttaaaacacagacactcacttcttttctcaggagaaac

 1.08 Intr +  14114  14272  159  0  0   91   53   204 0.950  17.16
ctgcccccctccctgcctgaaggcgagcagtgccagagccactgtatttaaaacacagac
actcacttcttttctcaggagaaacaagagccctgcttggagagttgattcactctgcag
ctgaccctcaggggctgggcagtttgcagcactctctctgaccagcttcttgtgccatag
GCTTCTTGCAAAGGACCAACAGCCTGGAAGAGAAGAGTCGCCTTGTGAGTGCCTTCAAGG
AGAGGCAATCCTCCAAGAACCTGCTTTCCTGTGAAAACAGCGACCGGGATGCCCGCTTCC
GGCGCACAGAGACTGACTTCTCTAATCTGTTTGCTAGAG
gtagcccctgccccactcccgccccatgctagccagtagatttcttatttgagtttcttg
actttttcctgcaattttacttcttttatcaagaaatgtcattattctctctgaacccac
atgaaactgcttttgtgactttgggggaatataattgactccctccctccctgctggcca

 1.09 Intr +  15589  15831  243  2  0   76  110   309 0.996  29.37
caaaacttctgtgtatgtgcatttttctggagatgtggtatatccgattctcagtgcaca
tacatatcccagaatgaaatcaggcctatacagatagcatggttaatattaggggtctct
gggctgaagaaatctagatatgagtcaggtgaaaaccattcattgctctccccaattcag
ATCTGCTTCCGGCTAAGAACGGTGAGGAGCAAACCGTGCAATTCCTCCTGGAAGTGGTGG
ACATACTCCTCAACTATGTCCGCAAGACATTTGATCGCTCCACCAAGGTGCTGGACTTTC
ATCACCCACACCAGTTGCTGGAAGGCATGGAGGGCTTCAACTTGGAGCTCTCTGACCACC
CCGAGTCCCTGGAGCAGATCCTGGTTGACTGCAGAGACACCTTGAAGTATGGGGTTCGCA
CAG
gtaaggaggagagttgggtagacaggtagtggcaactttgccctccatctcacccttgcc
agttgtgaggatatcaaacttgtgttggaagaaaaacacagccctggtgagataaggcgg
caaagtacccagtgaccacaagaacaagcttgggcagtaacagttggtggagggacccga

 1.10 Intr +  21432  21522   91  1  1  113  103    89 0.993  11.95
ttaatgttggtatagggtgggtcaacctgcccttcctttttcaatatccttgagcagcct
tattcgacatatcactgggatggaagccccatcagtgtgacccagtggggcaggccgttt
gccttcaagataggttgagaaatctgcatttgccttgatgcttttctgtttcctatctag
GTCATCCTCGATTTTTCAACCAGCTCTCCACTGGATTGGATATTATTGGCCTAGCTGGAG
AATGGCTGACATCAACGGCCAATACCAACAT
gtaagtctcatatgttttcatataagcaaccctgatgtatgactatggcttgttgcttta
aaagttcagtcccagtggttctattttattaaagtttccctggtcattttttctcttaaa
atctttaggtttatcacagttctgatttaatggtaaatacttgataaactattgttgaat

 1.11 Intr +  28684  28796  113  1  2   85   82    34 0.465   2.52
ggtttctgacattttatgatcggcgacttaatgcatttccaggaaatgaatcatgttagt
ggtttggaacagcttttttttagaacccaactacaaatactaaaccaatcctctgtgttc
ctaaaataagtggtttgacttctttattttctttcatccttcttcttaccacctttccag
GTTTACATATGAAATTGCACCAGTGTTTGTCCTCATGGAACAAATAACACTTAAGAAGAT
GAGAGAGATAGTTGGATGGTCAAGTAAAGATGGTGATGGGATATTTTCTCCTG
gtaggtttctcttctcttcctcttctcaaggtttgggattcttaagaatacaaaatatga
agtaggtttatggaagaataatgccttaacattttttttggataccctgacttcctattt
tttcaagatgaaggctaacaaaaatgctacattctatatgaattaactaacaaaggctat

 1.12 Intr +  30145  30260  116  2  2   62  109   206 0.970  20.27
ttcccagggtaaagggtccagtgggaagccccagcaatagggaagccagcaaaacctatc
aggatattatcctttcgcttcctgacctcccttgtctcttgagacaccagctcagcgttc
gtttttagaaacaataatcaaagagccccaacacctcccaatatgtccgcttgctgacag
GGGGCGCCATATCCAACATGTACAGCATCATGGCTGCTCGCTACAAGTACTTCCCGGAAG
TTAAGACAAAGGGCATGGCGGCTGTGCCTAAACTGGTCCTCTTCACCTCAGAACAG
gtgagtcggggatgctttctcatggatagtggtgttttttaggggactttccaacttcta
acctcgagcctctgtttgttgcagagtcactattccataaagaaagctggggctgcactt
ggctttggaactgacaatgtgattttgataaagtgcaatgaaaggtaggcaggggagggt

 1.13 Intr +  30345  30424   80  2  2  101  102     7 0.699   1.75
tacagcatcatggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcg
gctgtgcctaaactggtcctcttcacctcagaacaggtgagtcggggatgctttctcatg
gatagtggtgttttttaggggactttccaacttctaacctcgagcctctgtttgttgcag
AGTCACTATTCCATAAAGAAAGCTGGGGCTGCACTTGGCTTTGGAACTGACAATGTGATT
TTGATAAAGTGCAATGAAAG
gtaggcaggggagggtgaatattaggttcttgatgtattaaatgtgttcatctgttaaat
ttgttttattgtgcttaaggactggctcagtacattgtgccaagctgctaatggtctgtt
gaaaatatccgattaaattgctttttgctgctgctaaagtttttttcatgtgcaatctca

 1.14 Intr +  30648  30702   55  0  1   66   95    20 0.701  -0.52
gtgttcatctgttaaatttgttttattgtgcttaaggactggctcagtacattgtgccaa
gctgctaatggtctgttgaaaatatccgattaaattgctttttgctgctgctaaagtttt
tttcatgtgcaatctcattgactcttcattttaatttccctccttttccaataattatag
GGGGAAAATAATTCCAGCTGATTTTGAGGCAAAAATTCTTGAAGCCAAACAGAAG
gtatgtactccgtggtgcatctgaactccagttttaaaataccttctttctgtcctagac
aaaaacagtccttgataatatgagacaattttcttgtgcttctaaaattctattcttcaa
atttgcttatttccaactagtaaaataatttggttttaaagctgtgtctacacaatatca

 1.15 Intr +  32315  32431  117  1  0  102   95    70 0.998   9.76
gaataaatgaatgaatgagtgaatgagccaacaaaacactactagacatagtatctggta
atacataagttttgccatttactgttagaaataaatgttacacaattcttcttcctgtga
aaatcagcaaatgagaaaggttaaaaatactcatcagcctatatctgtcttaccttgtag
GGATATGTTCCCTTTTATGTCAATGCAACTGCTGGCACGACTGTTTATGGAGCTTTTGAT
CCGATACAAGAGATTGCAGATATATGTGAGAAATATAACCTTTGGTTGCATGTCGAT
gtaagtgctatataactcaggccagtccatgtggggggtggaggcacctcttttttatga
cttgcctcaagcttctccccacgccccagccagccctctctccacaccacattagttcca
gttcttgtctggaccctagccagccattcacaactggtacacaccacagacctggaacat

 1.16 Intr +  33925  33989   65  0  2  149   92    61 0.988  10.12
tgacaagcaatgaagaatcacaactgattgaacaatcagtgtgggctgaacttttctgag
aaacttatgtttttcaccttgtactttcttgctcatgttttagtagaagtgaggactgac
tagttttagattcttaaatgtcactgctcccctcttcctctcctttctctgtccccacag
GCTGCCTGGGGAGGTGGGCTGCTCATGTCCAGGAAGCACCGCCATAAACTCAACGGCATA
GAAAG
gtaacggccagaactcgccaggcctccttccacccagcacatcaaacagaccatgctctg
atgtcagcctgcaccaccctgccctgatccccagcatcatatttcggtctaagtttgctt
cagttcagcaggcatttgttgagcatttattggatgactgatttcccagtcaaatgagtc

 1.17 Intr +  37353  37464  112  0  1   81   67    80 0.860   5.58
ccgtaatgtaatactccgagactgcctgcaaaacatttgtttgctacttgattagtcaat
tcaggagaataggcatggataatatttactaacttgagttggaatgggtgttttcctcaa
gagaacagttgcgtctttccaactcctgcaccttctcgaagtctcatgtgcttctttcag
GGCCAACTCAGTCACCTGGAACCCTCACAAGATGATGGGCGTGCTGTTGCAGTGCTCTGC
CATTCTCGTCAAGGAAAAGGTCTGTACTCCCTCCAAAGCTACACTGGGGCCC
gtacgttctttagaaagcacaaaaagacacacgtggggtctctttgcagtacttgttggc
tgactcacgagattggcagccccactgagagactactgctgctgtcctttcctgcccttg
cagctaacctggtttcttctcttggctcttgctggctactgtgcttcttctttgatcagt

 1.18 Intr +  38512  38661  150  0  0   55   86   238 0.996  20.66
ggcagtttttccaagagtgattttagaaaagggcatcagaacaagtgtaaggcctcataa
agacatcagaagaaagattgcatatgaccccaagcccctccttccaagcagcctagtttt
aaagccacccacatctctgatgtgtaaatgcagatgcacccatcttaatttccatgatag
GGTATACTCCAAGGATGCAACCAGATGTGTGCAGGATACCTCTTCCAGCCAGACAAGCAG
TATGATGTCTCCTACGACACCGGGGACAAGGCAATTCAGTGTGGCCGCCACGTGGATATC
TTCAAGTTCTGGCTGATGTGGAAAGCAAAG
gtatgaagggaatagttcaggaaatagagcagaaatgtaatttgcacagactggctggca
aaagaggggcaaagatatatcacagataattcactatatggggaatcaatatctagataa
ttgaattaactgtgttttctttgtgaatgaaattactttattccttatgtcaaattctct

 1.19 Intr +  41657  41764  108  1  0   68   92   149 0.991  13.78
cacatcatttattgcatgcacatctgtgaaaaagctgacatatttgattagattgttctt
cctaaccagctccaaaaatactttttttgtttatttcccatagacagggacagcatagcc
ttcccaaatgctcatcacagggaaatgcaaccacaaacatgacttttctctttaaaacag
GGCACAGTGGGATTTGAAAACCAGATCAACAAATGCCTGGAACTGGCTGAATACCTCTAT
GCCAAGATTAAAAACAGAGAAGAATTTGAGATGGTTTTCAATGGCGAG
gtaggtaatcatcatggaccaggtacacagtatttccagaaaaactgctgagggaagctc
ctgaagcttctggcaacatgggaaaatcaatcccatgttgccagaaactgcttcaaaatt
tttattcttatacactcttaattcctctctttaattccttccatgtctatgaacttttct

 1.20 Term +  44348  44521  174  1  0   44   37   242 0.990  12.46
agggaacttgtgaccaggtagtcatttgatattagcccctgaagattcctggatatgaaa
tatttctttgcttttatgtcaatgtaaacacaaatagtaaaatgcaagttgggttgaatt
gttaaaaagagagggtgttcatatcaatcttgagttttgttttgtgttttccatcacaag
GTGGCTCCAAAAATCAAAGCCCTGATGATGGAGTCAGGTACGACCATGGTTGGCTACCAG
CCCCAAGGGGACAAGGCCAACTTCTTCCGGATGGTCATCTCCAACCCAGCCGCTACCCAG
TCTGACATTGACTTCCTCATTGAGGAGATAGAAAGACTGGGCCAGGATCTGTAA
tcatccttcgcagaacatgagtttatgggaatgccttttccctctggcactccagaacaa
acctctatatgttgctgaaacacacaggccatttcattgagggaaaacataatatcttga
agaatattgttaaaaccttacttaaagcttgtttgttctagttagcaggaaatagtgttc

Predicted peptide sequence(s):


>GAD1_1|GENSCAN_predicted_peptide_1|839_aa
ISPQSLCPGAFGRHRASAESRAGAPRKIFVRRLLRAARKFVSPVTFPMLTYPTLSGSVPR
EIWGPQGARSRRCTARLESGPGLRSLRPSTGASAHVSSAAPTPAHPYQAGSLPFLPLVSP
EPDLQGEPPCPRLLSPSGPRKSSPHSSRFSLQPVSAPDQSRTLDSRGPGTTELMASSTPS
SSATSSNAGADPNTTNLRPTSLMDVTLLIASNTCAKLEAPVRVGVRYLVRRGPWMHQKTG
AQDLRSLRRPQRSASAAVIVMQPAGQAELSEPWAAEDRPINSAGSIFSDCVSSFKALSWG
WSLEWKLSNLLNCFLQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFS
NLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNL
ELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTY
EIAPVFVLMEQITLKKMREIVGWSSKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGM
AAVPKLVLFTSEQSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGY
VPFYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERA
NSVTWNPHKMMGVLLQCSAILVKEKVCTPSKATLGPGILQGCNQMCAGYLFQPDKQYDVS
YDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFN
GEVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL