GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:23:43

Sequence FKBP1B_1 : 16320 bp : 47.94% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +     96    101    6  2  0   83   90     0 0.485   0.67
tcctcctgcctcggtctcctacagtgttgagattacaggtgtgagccattgttccaaaaa
ttgatatacttggcctcacatcaatttttggaacaATGCAG
gtaataatgagggggaaaaaattttaaaagtcccaattaccctttaaacaaatattacct
cctccaaaaaatatttttctagattcctgaatgtattttttggtggaggaggaactcaaa
gtagaattcatttacatattcattcattcattccacagcactaatcactccatgcagtaa

 1.02 Intr +   1188   1329  142  2  1   85   38    77 0.797   2.33
gtcagtgggttaatgtcgtcaggcggggccaggctcgctaacagccgggcggggtccctt
cccccgggccccgccccggccgaccccacctttccgcgcggctccgccccgccgccccct
tgccagtggcccctccccgcgcaggtcccgactccagccgcacctcctccggctctgcag
TGGCGGCGAGGAGGCGAGCCGGAGCGACGGCGGGGCTGGGGCCGGAGCCGAGCCGGGGTC
GGGCAGCAGCAGGGACCCCCCAGAGGCGGGGCCTGTGGGACCGCTATGGGCGTGGAGATC
GAGACCATCTCCCCCGGAGACG
gtaccgggctccctccggagccaggggaggggaggggtcccggggcggagcccggagggc
gggggtctgattcggaggtggcgtggagggtgctgaagggtcggggggctggatggggaa
ggcaggcggagacgccggacgggattcttgggggtctaggagaccatcctccgccatcct

 1.03 Intr +   1894   2001  108  2  0   80   53    50 0.620   0.96
tgctctcggatacccgctgctcggggacctcctcctagcgcgtcccccgccgggcctccc
ctcggtcgcttccctgcgggccgggctgtgagcggctgtggggacagacccaggctgggg
aagggggaagcgctcccttgcccgcttccggatctcgctttatcctgccgccgctttcag
ACTCCCTGGCCACCCTGTCCACTCCCATGGCCTCCACATTGAAGCTTCTAAGCCCAGCCC
TGCGACCTACGGCCGAACCTCTCCCTGGACGTCCCAGGGTGCTCCCTG
gtcagcaagtccaaaacagaactctcgcttcccaccttctctcctaagtgatcctcttta
tcccccttccgtgtctcactttcccaagtccttgtattactgggtctgggtgtgcaagga
atagccatttctttatttcttgaaatttaattaataccaaagcccccattgtctgcaggg

 1.04 Intr +   5345   5392   48  0  0  119  111    19 0.944   5.95
ccagagaggtgacgtgattcattctggctcgtacagggcccagagccagaactagggcca
caggcatctccatggcatggaggggaatgcaggctggagctcttggtcaggatcatactt
aatgtcccaggtgtttttccaatatcctactccttcatctgccctcatgtctccctgcag
GAAGGACATTCCCCAAGAAGGGCCAAACGTGTGTGGTGCACTACACAG
gtaagtctcaccccctcagcccccacccagtccttcccctcccaaggcagggctgtcctc
tgagcttctctccagaggtgcctgcctctggatcagggctaaagcccaaggcagcagggt
ctccctgtgaccagccatcctctactcctcccagccagtctagtgggaatgataaaggag

 1.05 Intr +  12257  12369  113  0  2   79   91   108 0.862  10.30
atgtgggggtgaggcagaaggaagtgtccagatttcctgcttgggcaacaggatggatgg
ggaggatcggaagaggagcaggtgtgtgcagaaaaggcattccattttagacatgtggaa
tctgaattgggagtttactcatgaccacagctctattgcacccgattcttgctttgacag
GAATGCTCCAAAATGGGAAGAAGTTTGATTCATCCAGAGACAGAAACAAACCTTTCAAGT
TCAGAATTGGCAAACAGGAAGTCATCAAAGGTTTTGAAGAGGGTGCAGCCCAG
gtaggatgaggattcgcattaaaggggatctggggagttggggatctgggatcagcactc
tgccctccacctccaccttcacccactcacagaccactactgctttgactctacagccag
ggcatggcaacgccatctggtgtcccctcctggctttgcgtccccacccctctccttgcc

 1.06 Term +  14507  14635  129  1  0   98   49   192 0.999  14.48
gaatctgcgtttgttaaagctgttagcacgatttcaatgtatcccatgtaaaattcatct
gagatcttcagagttaacattgaggatggtttgggaaaatgccatagtcatctaactttt
ttcttttaaatcaagctgggtcctctttctcctctccccatctgcccccatccctgctag
ATGAGCTTGGGGCAGAGGGCGAAGCTGACCTGCACCCCTGATGTGGCATATGGAGCCACG
GGCCACCCCGGTGTCATCCCTCCCAATGCCACCCTCATCTTTGACGTGGAGCTGCTCAAC
TTAGAGTGA
aggcaggaaggaactcaaggtggctggagatggctgctgctcaccctcctagcctgctct
gccactgggacggctcctgcttttggggctcttgatcagtgtgctaacctcactgcctca
tggcatcatccattctctctgcccaagttgctctgtatgtgttcgtcagtgttcatgcga

Predicted peptide sequence(s):


>FKBP1B_1|GENSCAN_predicted_peptide_1|181_aa
MQWRRGGEPERRRGWGRSRAGVGQQQGPPRGGACGTAMGVEIETISPGDDSLATLSTPMA
STLKLLSPALRPTAEPLPGRPRVLPGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPF
KFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNL
E