GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:35:55

Sequence EIF2B4_1 : 8370 bp : 51.53% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    667    928  262  0  1   88   44   122 0.024   3.16
gcccaccagggcagctgcggcctagctcggggaagcgacccggcctaagggcctacagga
gctcgggcgaccactgcacgaatcacacacatgagataagctcccagagaggccgtcggg
agtcggcggcccaggaccaggcccgaagggtggcggtcaggcctcagaggccgctccgag
ATGGCTCGGGCCCGTTATCCCCGCCCCTGCCCGGCCCGGCTCGGCTCCGGCCGCTCCTCA
CCACGTAGGCGGAGCCGCCGCTGTCCCCGCTGCGGGACTCGGTTTCGGGAATGGAAAAGT
GCATGTTCCCTACGGCACGGCACGGCCGGGCTCCGGACTGTGAGGGCCGCAGCGGCTCTG
CACGCTCCCCCTCCGCTGCTCAGCGAGTCCCCGCAGCCTCACTCGCCATTTTGGGAGCCC
TGCGATCCGATGTGGGAAGGCG
gtgggacgtcggttctgggacgcaatcgcctgggcatgctgggaactgtagtctaaaggg
caagagccacctgtccggatagggagcccaaagtggagttggccctcattgcaacccgta
gtgcggggcggggcctcggggcccgtcggaaattgtagtccgattggggctgcgcgcttc

 1.02 Intr +   1131   1250  120  1  0   13   96   117 0.037   5.97
caatcgcctgggcatgctgggaactgtagtctaaagggcaagagccacctgtccggatag
ggagcccaaagtggagttggccctcattgcaacccgtagtgcggggcggggcctcggggc
ccgtcggaaattgtagtccgattggggctgcgcgcttcgcttctgcggctcagcctccag
CCCAGGTGGCGCTGTGGACCCTGCAGCCGCGGAGCGAGGCAGCGGGGCGGCTCCGTGACC
ACGGCGGGCGGAGCCTAGGACTGAGGGCGATGGCTGCTGTGGCCGTGGCTGTTCGCGAGG

gtgagtgaagagccgggcctgcctactggtacgcggagccgacgagctccggacagctag
tgccgggccttgagcgcctttgggccccgccgctccgttccagcgccacgctgggctccg
gtctacacagtctcgagcgcagtcccgcgccgcgcaccggctggttgctgtgaggagggt

 1.03 Intr +   1615   1658   44  2  2   96   98     5 0.488   0.75
gacccctccattcctttgatccgccgcgcagtgcgtccccacgcggatccctggctcgcc
tcgcgcctgccggcggatccgtggtcatgccaacccagcagccggctgcgccgagtactc
gtgcccccaaaccctcccggagtctctctggctcactttgtgccctgttttctgatgcag
ACTCGGGATCCGGGATGAAGGCGGAGCTTCCCCCTGGGCCTGGG
gtaagtgaggcttccctcccaagccgcctgccaagcgctacgcaggaggctgtgccagct
ttattccgccccagctcccatcccgtgtcggtttatttctcagtaaagccaggagatttt
acagaggtcttgcaaccctagggatatatgattctgtccctggaggagaaacgtcagcct

 1.04 Intr +   1985   2120  136  1  1   38  113   150 0.491  13.15
tatgattctgtccctggaggagaaacgtcagcctctgtggatgtaagcttgcaacaggta
gcttgtggaagttaggaagaactagggatttaaccatgtggaaatcttgtaagcatccaa
tagtatttgttcccctttggaattgttggggaagagcagtatcctatgtctgtgtctcag
GCAGTGGGGAGGGAAATGACCAAAGAAGAAAAGCTGCAGCTTCGGAAGGAAAAGAAACAG
CAGAAGAAGAAACGGAAGGAAGAAAAGGGGGCAGAACCAGAGACTGGCTCTGCTGTATCT
GCAGCCCAATGTCAAG
gtgagtgaggggtctcttttaaagggctggggtgtggagctggtagagggatgtggtggg
agagataagggagagacaggacaaagttgatttgagcaagtgtgtaaagcaaagaggttt
acaaggagagaagctagttttagctggggcacggatatcacctgcctgcagcttgggcat

 1.05 Intr +   2322   2528  207  1  0   40   70   175 0.613  10.47
aagggctggggtgtggagctggtagagggatgtggtgggagagataagggagagacagga
caaagttgatttgagcaagtgtgtaaagcaaagaggtttacaaggagagaagctagtttt
agctggggcacggatatcacctgcctgcagcttgggcatttttttttttaatgcttttag
TAGGCCCAACCAGAGAACTGCCAGAATCGGGCATTCAGTTGGGCACTCCTCGGGAGAAAG
TTCCAGCTGGTCGGAGTAAGGCCGAACTTCGGGCTGAGCGTCGAGCCAAGCAGGAGGCCG
AGCGGGCCCTGAAACAGGCAAGAAAAGGGGAACAAGGAGGACCACCTCCTAAGGCCAGCC
CCAGCACAGCTGGAGAAACCCCCTCAG
gtatcttcccttcattttaagacctcccttactcctaattataacgccagctcaggctgc
ccaatagtaaaacagctctcccctctcattcttgggacccagagttctgaattgttcctg
caaccccattatcctatccctatttccttttctaccctattctcccgttttctccacctc

 1.06 Intr +   2801   2880   80  0  2   43   91    69 0.794   2.47
tgggacccagagttctgaattgttcctgcaaccccattatcctatccctatttccttttc
taccctattctcccgttttctccacctcatcctgtttttcttgatgccccttatacccta
agagcaaattacacatttcaagacctacagtgtcctgaaaacatgatgattatctttcag
GAGTGAAGCGTCTCCCTGAGTACCCTCAGGTTGATGACCTACTTCTGAGAAGGCTTGTTA
AAAAACCAGAGCGTCAACAG
gtaggaagtgggtttggtgcctggctagaaagagcctagggaaatggactggagggagga
aaggtgctgggtgcaaagtgagaaggataggtgcttgggtcagagtagtcttactgttca
cttcctttccagctttatcccatcctttttaaactctgggccattggtcctgttcccttg

 1.07 Intr +   3013   3209  197  0  2   85   83    30 0.622   0.93
gatgacctacttctgagaaggcttgttaaaaaaccagagcgtcaacaggtaggaagtggg
tttggtgcctggctagaaagagcctagggaaatggactggagggaggaaaggtgctgggt
gcaaagtgagaaggataggtgcttgggtcagagtagtcttactgttcacttcctttccag
CTTTATCCCATCCTTTTTAAACTCTGGGCCATTGGTCCTGTTCCCTTGTTTTGTCAAGGT
TCCTACACGAAAGGATTATGGATCCAAAGTCAGTCTCTTCTCTCACCTACCCCAGTACAG
CAGACAAAACTCTCTGACCCAGTTTATGAGGTAGGATCCTATGAAATTGTCATAACTTTT
GAGTCTGAGGAGTTTTA
gtaagtcagtattgaaagtttctagtaatctgagatggactctgtaggaaaaagtatgaa
cccaaggcagaactgtagaggagtggggaaatctgctagtgaagggagttccttttcatc
aggggcaggtgggcagtagatgctcaagctccctttcaaagtatgtgacaccgccatccc

 1.08 Intr +   3395   3509  115  2  1   31   91    85 0.744   4.05
tcagtattgaaagtttctagtaatctgagatggactctgtaggaaaaagtatgaacccaa
ggcagaactgtagaggagtggggaaatctgctagtgaagggagttccttttcatcagggg
caggtgggcagtagatgctcaagctccctttcaaagtatgtgacaccgccatcccatcag
CATCCCATCCTCTGTGATCCACCCAGCCATGGTGCGACTCGGCCTGCAGTACTCCCAGGG
CCTGGTCAGTGGCTCCAATGCCCGGTGTATTGCCCTGCTTCGTGCCTTGCAGCAG
gtatgtcccatcctgttctctcttatgatccaaccccacctcccccaatactaccccagc
ttctgtcacccaaggtcatctctgggggacagagggaatactcctaccctcagaacattt
tcctcagtgaagcttacccccagcccccgttcagagatctttattaaggggtattttgca

 1.09 Intr +   3712   3788   77  0  2   59   75    56 0.874   0.21
ttatgatccaaccccacctcccccaatactaccccagcttctgtcacccaaggtcatctc
tgggggacagagggaatactcctaccctcagaacattttcctcagtgaagcttaccccca
gcccccgttcagagatctttattaaggggtattttgcagatcaccttgtgtaccctatag
GTGATTCAGGATTACACAACACCGCCTAATGAAGAACTCTCCAGGGATCTAGTGAATAAA
CTAAAACCCTACATGAG
gtagggacaacactataagtccactcccagctcgcccaatctttgtcttgtactcttttt
cctgcttttctatctctcttttcattttgtgttctattttctttttaaagactttttttt
taaatgtgaaggctttgtaagttgtgaagagttgcgcagatataaggtattgctgttgta

 1.10 Intr +   3975   4158  184  0  1   27   85   159 0.709   9.81
acaacactataagtccactcccagctcgcccaatctttgtcttgtactctttttcctgct
tttctatctctcttttcattttgtgttctattttctttttaaagactttttttttaaatg
tgaaggctttgtaagttgtgaagagttgcgcagatataaggtattgctgttgtattatag
CTTCCTGACTCAGTGCCGTCCCCTGTCAGCGAGCATGCACAACGCCATCAAGTTCCTTAA
CAAGGAAATCACCAGTGTGGGCAGTTCCAAGCGGGAAGAGGAGGTGATGAGTATGAGAAA
TAAGGAAGGCATGCACCTGTGGGTAAAATTAAGAAACATGTTAAAAACTCCCGGGAAGGC
CAAC
gtaagcctttttttgccctagtcaagggttaaggaatggtttggccattctgacttgtgc
catctctgagccctctataggcttgtcatcatacacatattcaagcacctggcatgatca
tcagagggataaaagtgtccatttcttgttcactaaggattttactccatttaggccaag

 1.11 Intr +   4333   4460  128  0  2   50   56   199 0.994  12.88
gccaacgtaagcctttttttgccctagtcaagggttaaggaatggtttggccattctgac
ttgtgccatctctgagccctctataggcttgtcatcatacacatattcaagcacctggca
tgatcatcagagggataaaagtgtccatttcttgttcactaaggattttactccatttag
GCCAAGTCAGAACTTCGAGCAGCCATTGATCGGTATGTGCAAGAGAAGATTGTGCTAGCA
GCTCAGGCAATTTCACGCTTTGCTTACCAGAAGATCAGTAATGGAGATGTGATCCTGGTA
TATGGATG
gtatggtccagaccttgtgactgagcagattgggagttggaatgatctgaagaagggact
acccacttgcctttgggaataagttagtcatcagttactgacatttataactgaatcctc
ctcttcattcactctagctcatctctggtatcacgaattcttcaggaggcttggacagag

 1.12 Intr +   4598   4775  178  2  1  101  107    66 0.960  10.24
accagaagatcagtaatggagatgtgatcctggtatatggatggtatggtccagaccttg
tgactgagcagattgggagttggaatgatctgaagaagggactacccacttgcctttggg
aataagttagtcatcagttactgacatttataactgaatcctcctcttcattcactctag
CTCATCTCTGGTATCACGAATTCTTCAGGAGGCTTGGACAGAGGGCCGGCGGTTTCGGGT
GGTAGTGGTGGACAGCCGGCCATGGCTGGAAGGAAGGCACACACTACGTTCTCTAGTCCA
TGCTGGTGTCCCAGCCTCCTACCTGCTGATTCCTGCAGCCTCCTATGTGCTCCCAGAG
gtaagtacagaggaaaaggactccaaagttggcggtgaaaaggtgtagtagtatagacat
aatctcaccttcccaaagttacagttttgtttttgttttgagataaggatggagtgcagc
gacgtgatcacagctcactgcagtcttgacctcctgggctcaggtgatcttcccacctcc

 1.13 Intr +   6636   6816  181  2  1   94   82   101 0.998  10.06
atctcaaagaaaaaaaaaaaaaagatttattacttgttgtctgtttttgtttctttccct
tcttttcacaggtgttgagatttattacttgtcttaatgttgctgtcctgtaagtagggg
accttattttgcattgatacaacaatgacatttttttcttcctcttctcctgtgaaacag
GTTTCCAAGGTGCTATTGGGAGCTCATGCACTCTTGGCCAACGGGTCTGTGATGTCACGG
GTAGGGACAGCACAGTTAGCCCTGGTGGCTCGAGCCCATAATGTACCAGTGCTGGTTTGC
TGTGAAACATACAAGTTCTGTGAGCGTGTGCAGACTGATGCCTTTGTCTCTAATGAGCTA
G
gtaaggaggcaaaagagaagcctccagctacctgtgaagacttgagagggagggagaggg
gcggataaactagaacttcttttctgaaagaacataatgggtacgccttccattgcagat
gaccctgatgatctgcaatgtaagcggggagaacatgttgcgctggctaactggcagaac

 1.14 Term +   6935   7134  200  0  2   68   49   128 0.978   4.78
ctgtgaaacatacaagttctgtgagcgtgtgcagactgatgcctttgtctctaatgagct
aggtaaggaggcaaaagagaagcctccagctacctgtgaagacttgagagggagggagag
gggcggataaactagaacttcttttctgaaagaacataatgggtacgccttccattgcag
ATGACCCTGATGATCTGCAATGTAAGCGGGGAGAACATGTTGCGCTGGCTAACTGGCAGA
ACCACGCATCCCTACGGTTGTTGAATCTAGTCTATGATGTGACTCCCCCAGAGCTTGTGG
ATCTGGTGATCACGGAGCTGGGGATGATCCCTTGCAGTTCTGTACCTGTTGTTCTACGAG
TCAAGAGCAGTGACCAGTGA
cgggggaaacacagggttaataaatgccatactccctaccctcagcaactctgctgcctt
tgtttctcttttagcatctccaccacttaagttaggagtccagacttcacaacccctttt
atcacctgctactcagacctttgtgaagacctgctcaagtaactagctccatgccagtac

Predicted peptide sequence(s):


>EIF2B4_1|GENSCAN_predicted_peptide_1|702_aa
MARARYPRPCPARLGSGRSSPRRRSRRCPRCGTRFREWKSACSLRHGTAGLRTVRAAAAL
HAPPPLLSESPQPHSPFWEPCDPMWEGAQVALWTLQPRSEAAGRLRDHGGRSLGLRAMAA
VAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSA
VSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKGEQG
GPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQLYPILFKLWAIGPVPLF
CQGSYTKGLWIQSQSLLSPTPVQQTKLSDPVYEVGSYEIVITFESEEFYIPSSVIHPAMV
RLGLQYSQGLVSGSNARCIALLRALQQVIQDYTTPPNEELSRDLVNKLKPYMSFLTQCRP
LSASMHNAIKFLNKEITSVGSSKREEEVMSMRNKEGMHLWVKLRNMLKTPGKANAKSELR
AAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVVV
DSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGTA
QLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHAS
LRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ