GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:45:51

Sequence EIF2AK3_1 : 73233 bp : 38.88% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1503   1810  308  2  2   52   94   509 0.996  42.71
tcaggtggcagcggcagaggccgggctgagacgtggccaggggaacacggctggctgtcc
aggccgtcggggcggcagtagggtccctagcacgtccttgccttcttgggagctccaagc
ggcgggagaggcaggcgtcagtggctgcgcctccatgcctgcgcgcggggcgggacgctg
ATGGAGCGCGCCATCAGCCCGGGGCTGCTGGTACGGGCGCTGCTGCTGCTGCTGCTGCTG
CTGGGGCTCGCGGCAAGGACGGTGGCCGCGGGGCGCGCCCGTGGCCTCCCAGCGCCGACG
GCGGAGGCGGCGTTCGGCCTCGGGGCGGCCGCTGCTCCCACCTCAGCGACGCGAGTACCG
GCGGCGGGCGCCGTGGCTGCGGCCGAGGTGACTGTGGAGGACGCTGAGGCGCTGCCGGCA
GCCGCGGGAGAGCAGGAGCCTCGGGGTCCGGAACCAGACGATGAGACAGAGTTGCGACCG
CGCGGCAG
gtgaggggctgccgacccgggggaggcaacttgtttacgcgcgcgagccgcggaggatgc
ggtgtaggggggcggagatccgggacccgggcgggcgtcttccctcggctgcggagggca
gctggcgacctggggacgagcgcggggccacgacgccctcccatcccccggccagcgacc

 1.02 Intr +   1927   2052  126  1  0  -22   80   150 0.731   2.07
cgggagagcaggagcctcggggtccggaaccagacgatgagacagagttgcgaccgcgcg
gcaggtgaggggctgccgacccgggggaggcaacttgtttacgcgcgcgagccgcggagg
atgcggtgtaggggggcggagatccgggacccgggcgggcgtcttccctcggctgcggag
GGCAGCTGGCGACCTGGGGACGAGCGCGGGGCCACGACGCCCTCCCATCCCCCGGCCAGC
GACCTGCCTGGGCTCGGCTCCCGAGGGCCTGGTGCTGGCCGACGGGTCAGAGCAGCATCC
TCGCAG
gtgcgggagaatggaattccagggttgcaaagaaacgccacttcccctctttcattgttt
tcgggcattgattctcttccaaggaacctttccctctttttccttacgcacatcacctcc
tgtctgtgctggcgtgacagctgttttgagaaaggactttagcaaaagacgtctgcattt

 1.03 Intr +  13904  14005  102  2  0   64   85    50 0.184   0.67
tgaaagagctggcatcagaagtttgaggaacagggagacatgaatggttaacatggttca
gtggcataatggatagactagggaagggtgttatgattgttgagcattgttagtagcctt
tttgaggttggtggtcgttaattaaagtgaggatagtcaacatggtatgtttctcttcag
ATACGTTCAACTGCACAGATGTAGGAGTGAGAAAGGGGAGAAGATTGACTTTAACCAGTT
CTTCCAGAGTGTGACATGTGAGAGGCAGGGTAGGGAGTTGAG
gtgtgtgcaaagtagtgcttaagatgaaggactgtgggattttaactggttaagaaagaa
gtgagggcatggtggtagtgaaggttgtagtatcagtggcttgtaggttctcatagggtc
agaagtttcttggagtcagggaagtagaggaagtgagctgaaaagagaggggttggtggt

 1.04 Intr +  14924  15053  130  2  1   83   94    76 0.809   7.48
taaagggcatattgaaattgtcttggtccaaagacagtggtggcaagagtggtagaaggc
cccctcttcctttctacgaatagaggcctggacatgggctggttttcttttgagcatgtg
ggataagtgcccaatatcttagatatctgttaattttaaaaatatttttaatatttacag
GTCATTAGTAATTATCAGCACTTTAGATGGGAGAATTGCTGCCTTGGATCCTGAAAATCA
TGGTAAAAAGCAGTGGGATTTGGATGTGGGATCCGGTTCCTTGGTGTCATCCAGCCTTAG
CAAACCAGAG
gtaagaattttctgttaactgttgactagaaaacttaattctaatgagtaattgctgata
ttaagaagtttggggccctattgcccaggtttgaggcctgtctgcctcttacagtttgtg
tccctttagggcaattacttaacttttctattcctcagttcccctcttgtgaaatgagat

 1.05 Intr +  33114  33308  195  2  0   65  115   185 0.981  17.59
gatggactgcactgcttcatgtgctactcagaaggaggctggagtacatcaggatcaaga
ctccagctcttaattactattattcttttaaaggtatgatgcttctatttttctgggaga
aataagaaaaaaataataattaatgttatggcccttttaaaaagttagcttctgttttag
GTATTTGGGAATAAGATGATCATTCCTTCCCTGGATGGAGCCCTCTTCCAGTGGGACCAA
GACCGTGAAAGCATGGAAACAGTTCCTTTCACAGTTGAATCACTTCTTGAATCTTCTTAT
AAATTTGGAGATGATGTTGTTTTGGTTGGAGGAAAATCTCTGACTACATATGGACTCAGT
GCATATAGTGGAAAG
gtaagtgaaaatgctgaatttactttggggaaatcagagtaaattagggtagaaaaagta
atttattaaactacacttattattagttgagttttattgtaattttcccctgaggttgtc
atttgttttaataagagaactgtgaggtaggaaggggaaactaataacagaataaatggc

 1.06 Intr +  35372  35505  134  1  2  130   28   121 0.996   8.82
gttctaaataactcattttaggagttggtaatctaactgatgcttcttatgacttgagta
cttcatacacatttccttagtttcctttcactttttaaaaattacagattcctttaatat
ctctgatctattatgagttgtctccttttactaattttgtatctaattttgtcttttcag
GTGAGGTATATCTGTTCAGCTCTGGGTTGTCGCCAATGGGATAGTGACGAAATGGAACAA
GAGGAAGACATCCTGCTTCTACAGCGTACCCAAAAAACTGTTAGAGCTGTCGGACCTCGC
AGTGGCAATGAGAA
gtgtgtattcagataatgttgctgttggtattatttagaaatacacctaataccaaaatt
tatcagatttctgtttgtggagattttgactattttgttgccttaaaagcatatatatat
atatttttttgatacggagtcttgctctgtcgcccaggcttgagtacagtggcgtgatat

 1.07 Intr +  37725  37959  235  0  1   58   82   279 0.988  21.07
aaagttcttgtgggccctcttgtggcataaatcagtagagcactcttttccagaaggtta
tgttgttagttttctcatcacataattttagtatttgcttcttcaatctagaagagttct
atattattttgtccctttctttaaatgtaaatttctaaaacacacctttgtaaatttaag
GTGGAATTTCAGTGTTGGCCACTTTGAACTTCGGTATATTCCAGACATGGAAACGAGAGC
CGGATTTATTGAAAGCACCTTTAAGCCCAATGAGAACACAGAAGAGTCTAAAATTATTTC
AGATGTGGAAGAACAGGAAGCTGCCATAATGGACATAGTGATAAAGGTTTCGGTTGCTGA
CTGGAAAGTTATGGCATTCAGTAAGAAGGGAGGACATCTGGAATGGGAGTACCAG
gtacctaacaccactgaggatttaaaatacggttcttcctctcccagtctgaccaaactt
attgattgggtggaacgaaattactactacttggggctctcagcttgttctctgtgcttt
tataaatttgtgattttaaatggtattttatgggttggaactatataactactgcttgaa

 1.08 Intr +  38172  38334  163  2  1   59   92   207 0.901  16.83
ttcttcctctcccagtctgaccaaacttattgattgggtggaacgaaattactactactt
ggggctctcagcttgttctctgtgcttttataaatttgtgattttaaatggtattttatg
ggttggaactatataactactgcttgaattatttaagaccttttttccatttttgtttag
TTTTGTACTCCAATTGCATCTGCCTGGTTACTTAAGGATGGGAAAGTCATTCCCATCAGT
CTTTTTGATGATACAAGTTATACATCTAATGATGATGTTTTAGAAGATGAAGAAGACATT
GTAGAAGCTGCCAGAGGAGCCACAGAAAACAGTGTTTACTTGG
gtgagtaaatgtatcttatctaacgatagtacacattgacatctagattttcttcttaca
ttgttccttcctacttcaggagtgcctgtagtagttttaaatcctaatatcatctctgat
gtacgttgcccttgagatttatacttcgatttccattcctgctacttttccatttgtcca

 1.09 Intr +  39876  40016  141  1  0   45   88   104 0.970   5.50
ccctccctgtttttgttgaataaacattgagtttatctttgagtgcttcaagcatgtttc
ttctttgacaagagttttgtggtgtatgtagaaataactggaattaatgtaattttattt
aattaaaaaaacctttttaaaaaaatcaatgcataattgacaatgttctggttgattcag
GAATGTATAGAGGCCAGCTGTATCTGCAGTCATCAGTCAGAATTTCAGAAAAGTTTCCTT
CAAGTCCCAAGGCTTTGGAATCTGTCACTAATGAAAACGCAATTATTCCTTTACCAACAA
TCAAATGGAAACCCTTAATTC
gtaagtgaattgtaaacttttctaaatactgttagtgttcagagacctaatcctgactgt
ctttgccctagttttgaatactgcagagataagaactgttatatactttatattttattg
ataaaccatgatggtatttcagatgttaataatgaatttttattttcatttagagcatca

 1.10 Intr +  40703  40795   93  0  0   59  115    48 0.796   3.62
gagctctgggccatttgtttaacttatatgtttgaattgaattatggttgaatatcagtt
tattcaattaagcacgtgcatttttattcaagtcataacagttcagacttaagaaatatt
attattaagaaaataataattttcttttagattctccttccagaactcctgtcttggtag
GATCTGATGAATTTGACAAATGTCTCAGTAATGATAAGTTTTCTCATGAAGAATATAGTA
ATGGTGCACTTTCAATCTTGCAGTATCCATATG
gtaagtgaaaatactgagttttatttattttattttttaatttgaaattaatagaattca
aatgaagaaaagtcgattagagtatagacaataaaacatcttgggagacaatttcatgaa
tgattactaagcatacaagctccaaagttaggttgccagggttcagatcccatttttgcc

 1.11 Intr +  42716  42936  221  0  2   37   90    76 0.706  -0.20
ctatatttacgggagaaaaatgagacaaattaagatgtttaaaatacgttaaagaagaga
gacaaaacttaaaaggaattaatgtgataagtcacaggaaaatggataaattttaatagt
taaagacgggcctatttttgattacctttaaaaaaaacgttttaatgtttctatttgaag
ATAATGGTTATTATCTACCATACTACAAGAGGGAGAGGAACAAACGAAGCACACAGATTA
CAGTCAGATTCCTCGACAACCCACATTACAACAAGAATATCCGCAAAAAGGATCCTGTTC
TTCTTTTACACTGGTGGAAAGAAATAGTTGCAACGATTTTGTTTTGTATCATAGCAACAA
CGTTTATTGTGCGCAGGCTTTTCCATCCTCATCCTCACAGG
gtaagaatcatggttgcttactgtctggtttccacttccccacctcctatttgcttctca
acccatcacagtctggcttccatccctactgctccaccaaagctactcttgccaaagttc
tcagtgatcttccttgtgttaaatgtaatggacatttttcagtccttatctaactgaacc

 1.12 Intr +  45235  45347  113  0  2   55  107    15 0.014  -1.64
gaagataaactttttttcttttataataaagcaaaatgctgcactttgttttcataatgc
ttttatttttcttgatgctacttatgtatttttcagtgttgtttattttataacctaaaa
ttgttagctaacttcagttcagctttgtactggtagtgattttgtttttcaccttatcag
CAAAGGAAGGAGTCTGAAACTCAGTGTCAAACTGAAAATAAATATGATTCTGTAAGTGGT
GAAGCCAATGACAGTAGCTGGAATGACATAAAAAACTCTGGATATATATCACG
gtaagagtcttataaaatacaaccatctgaatcaaagaagaaatgacctaagatcttgtt
taactttttttttaatgtgtggatatctagaaaaataaaacataggcttaaccctcaata
aataaataaattcaggtaacttaaatgtattaaaagtggtatataccctaagaaagataa

 1.13 Intr +  52074  52223  150  0  0  102   88   120 0.992  11.76
aacagccttcagtgttgtcttactttctctctttttcaggctaattttatttctttaatt
ttccttttttattggtatataatacatctacatattttaggggtataagtcatataattt
gtaaagatcaaatcagtgtaattggaatatccatcaccttaaatattttctctctttcag
GGAATTGGCTCGGGAAAAGGTAATGCGAGAAGTTAAAGCCTTAGCCAAGCTTGAACACCC
GGGCATTGTTAGATATTTCAATGCCTGGCTCGAAGCACCACCAGAGAAGTGGCAAGAAAA
GATGGATGAAATTTGGCTGAAAGATGAAAG
gtaactaactttgttacacatacacttaagctagttttttgcttgtgtgattacaatgtc
agttttataactttagggatttttttttttaaagaaaaggaacagcagagttctgttgtt
tcatgttttgaaaagttctctagccacttgtgaaattttggtttagattttgagaacata

 1.14 Intr +  53331  54111  781  0  1   82   66   512 0.929  38.95
tgaatggaatgtgatgttctgtatctcacattgcatgtttttatttagtttgtatgttgt
tttgttgtcatttggtaagtggccttattacagttgaagctttttaaacagagggtgcag
ttcaggtacttgaatcaatatatattcactcttacccctttgtatttctcccacttttag
CACAGACTGGCCACTCAGCTCTCCTAGCCCAATGGATGCACCATCAGTTAAAATACGCAG
AATGGATCCTTTCGCTACAAAAGAACATATTGAAATCATAGCTCCTTCACCACAAAGAAG
CAGGTCTTTTTCAGTAGGGATTTCCTGTGACCAGACAAGTTCATCTGAGAGCCAGTTCTC
ACCACTGGAATTCTCAGGAATGGACCATGAGGACATCAGTGAGTCAGTGGATGCAGCATA
CAACCTCCAGGACAGTTGCCTTACAGACTGTGATGTGGAAGATGGGACTATGGATGGCAA
TGATGAGGGGCACTCCTTTGAACTTTGTCCTTCTGAAGCTTCTCCTTATGTAAGGTCAAG
GGAGAGAACCTCCTCTTCAATAGTATTTGAAGATTCTGGCTGTGATAATGCTTCCAGTAA
AGAAGAGCCGAAAACTAATCGATTGCATATTGGCAACCATTGTGCTAATAAACTAACTGC
TTTCAAGCCCACCAGTAGCAAATCTTCTTCTGAAGCTACATTGTCTATTTCTCCTCCAAG
ACCAACCACTTTAAGTTTAGATCTCACTAAAAACACCACAGAAAAACTCCAGCCCAGTTC
ACCAAAGGTGTATCTTTACATTCAAATGCAGCTGTGCAGAAAAGAAAACCTCAAAGACTG
GATGAATGGACGATGTACCATAGAGGAGAGAGAGAGGAGCGTGTGTCTGCACATCTTCCT
GCAGATCGCAGAGGCAGTGGAGTTTCTTCACAGTAAAGGACTGATGCACAGGGACCTCAA
G
gtctgtatttgtggagcatcacccttggggtttcaatctgacgttttgtgattcagagca
gtacttgcagtactctgaaggatccttaagagttggggagagtaaaagcatctgagagca
gaggtctgagaaagtagcctcgaaggggcctgctgcaagaataagaagtcttatgtctga

 1.15 Intr +  57736  57903  168  0  0   91  109   173 0.987  18.92
gcagtacttgtctggcacagaaaaattgtcactattttcctgttagcccattttaaaaag
aaatatgcttgaaaatatctagtttgttgtattttttctttgtagtcttttaaataattc
tctttactttttcgcctccatgcacacccactgtacttttgtctgttgtattctttccag
CCATCCAACATATTCTTTACAATGGATGATGTGGTCAAGGTTGGAGACTTTGGGTTAGTG
ACTGCAATGGACCAGGATGAGGAAGAGCAGACGGTTCTGACCCCAATGCCAGCTTATGCC
AGACACACAGGACAAGTAGGGACCAAACTGTATATGAGCCCAGAGCAG
gtgagtttttcagacctttacttactagcacagcagcagatgtacctgatgaatctcttc
tcatgttttcattaaaatacccagtaatctaaaacccagtaagtctgaaaattatgaaaa
ctggcagtagtgttccagtagtggaatagtgacacagctaagatgtagtttctacaacct

 1.16 Intr +  66387  66488  102  2  0   53  110    24 0.192   0.55
ctcttggtgtagtagtgaagaaaagagacttgggagattaactctttgctaacattttta
cacatgtacttgcatttaaaccaagaagtgactaagtaaactttgggattcaataatgct
gtaatatcaactgtactgtctctgtgttaatttttaaattttctttatgtgggatttcag
ATTCATGGAAACAGCTATTCTCATAAAGTGGACATCTTTTCTTTAGGCCTGATTCTATTT
GAATTGCTGTATCCATTCAGCACTCAGATGGAGAGAGTCAGG
gtaagtaccctccctactcaaaaaaaaagtttcaaacagaaaataatctaacatttacaa
aagagttttttaaagacttagttcttcttaataccagcagattggttaactaaaagtgaa
agaggtgatgtgagtaacacagagaggagttctagactatttgcttccatttaaagctca

 1.17 Intr +  69798  69860   63  2  0  121   87     1 0.235   1.30
ttgatggagtgtacatctgtgctcaggaaacatatgtagttattaaatcaggaaaagcta
ttgataaattttccatttgatagatgtacaacctcttagtcattttgttagagtatcaaa
aaatattttcatgttgtatgtcaaaataaacttaataagtgatactttttttctttttag
ACCTTAACTGATGTAAGAAATCTCAAATTTCCACCATTATTTACTCAGAAATATCCTTGT
GAG
gtatgtgtaattctcatcttttatcttctttagaatcatctttagaacgtaagcggtcct
tagcagtcgactcagtttcccctattttacagatgaggaagccaaaggtctagagaggaa
agagacctgctcccaagagcccagaatttgttaaaaccaaacactggagctggggcctgg

 1.18 Term +  70841  71041  201  1  0   54   38   184 0.342   6.41
gtctctggatgcttttgtgcattgacggcagagctgagtagttgtatcagagacttgaaa
actcgaatatggctcaaaagcttaaaatatgtacagaaatattttgccagcactgatttt
aaaaactgtacagtgatcaaacctggccgttttatcacaaaacaatttttatattttcag
TACGTGATGGTTCAAGACATGCTCTCTCCATCCCCCATGGAACGACCTGAAGCTATAAAC
ATCATTGAAAATGCTGTATTTGAGGACTTGGACTTTCCAGGAAAAACAGTGCTCAGACAG
AGGTCTCGCTCCTTGAGTTCATCGGGAACAAAACATTCAAGACAGTCCAACAACTCCCAT
AGCCCTTTGCCAAGCAATTAG
ccttaagttgtgctagcaaccctaataggtgatgcagataatagcctacttcttagaata
tgcctgtccaaaattgcagacttgaaaagtttgttcttcgctcaatttttttgtggacta
ctttttttatatcaaatttaagctggatttgggggcataacctaatttgagccaactcct

Predicted peptide sequence(s):


>EIF2AK3_1|GENSCAN_predicted_peptide_1|1141_aa
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRAAGDLGTSAGPRRPPIP
RPATCLGSAPEGLVLADGSEQHPRRYVQLHRCRSEKGEKIDFNQFFQSVTCERQGRELRS
LVIISTLDGRIAALDPENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQW
DQDRESMETVPFTVESLLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQW
DSDEMEQEEDILLLQRTQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFK
PNENTEESKIISDVEEQEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWL
LKDGKVIPISLFDDTSYTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRIS
EKFPSSPKALESVTNENAIIPLPTIKWKPLIRSDEFDKCLSNDKFSHEEYSNGALSILQY
PYDNGYYLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCII
ATTFIVRRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRELAREK
VMREVKALAKLEHPGIVRYFNAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSV
KIRRMDPFATKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESV
DAAYNLQDSCLTDCDVEDGTMDGNDEGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDN
ASSKEEPKTNRLHIGNHCANKLTAFKPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKL
QPSSPKVYLYIQMQLCRKENLKDWMNGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMH
RDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQ
IHGNSYSHKVDIFSLGLILFELLYPFSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQ
DMLSPSPMERPEAINIIENAVFEDLDFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPS
N