GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:21:35

Sequence EDAR_1 : 97299 bp : 48.77% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   5043   5236  194  2  2   86   70   203 0.669  16.74
tgttatttctcaaatgctggatgcccaagggtggcaaacacactgtttggaccccaggaa
ggagcagacacatgtgggtgaagctggaggtcctgcttccttgcccagatcctcttgccc
agacacactctggaaatgcccatcattttatacacctacgtacacatgtaaccagccagg
ATGCCTTTGTTTTCCATTTCCGAGAAAACAGAGGACTATGGAAAACAGGTGGGCCGTAAG
GAGCCCTACAGAGGAAGATGCACCTGTGGCGGTAGCCCTGCCTGCACCACCCTGCGAGCT
CATGCCAGCTTAACTCACTTCACGGTCAATCAGACCTACTGCTCCAAACACAGTAGGAAG
GCGCGCCTTCACTT
gtgagtcggacgaaatcagcaatgagggcaataacaaccacagtcacgttactcttagta
acagccctgaggcccgcagtgtagcacagaagccaagcttagtggtgggcttaaggctga
tgttgttaactgataccattcaatagctagatataggcaactaaaaggtgagcccaaata

 1.02 Intr +  28998  29096   99  0  0   90   42    55 0.001   0.33
ttctcacctcttccaggaagcctccccaggcttttccgcacccacccaaggctgagctga
gcccaaggccccttgcatcagaatgaatgtgttctgaccatagagtttcagaaaagaaaa
cgtaacaataacaccatctgccagtgagtgcttttttaatgtaaatgtctgtttttgcag
AACGTCCATAACCAAAAGAGCAGTTCAACCTTCAGCATGTAAATCTGATGTAGGCAGCGG
GAACCAGGAGCTCTACCTCCCTCTGAAGAGGGCCTGGCT
gtgagcagggcagggcagccaaggagggtggctggtcccagagaagctgtgctccaatgc
tggctcctccctgcctgcctccactggtggtgggtgtgccagatgcccttgagtgagtga
ggggaggtcagcctagactggtgggtcctgggggcagaggcctccaggctgcagtgtgtc

 1.03 Intr +  42800  43364  565  2  1   98   39    94 0.008  -1.70
ttggaaaatttgcaacctaactatatggtagaaaagaaaaacccattttctggggaggaa
ttcaaactggctgcagaaatttgcataagtaacaaggagttgaatgttaatagtcaagac
agtggaggaaatgtctccagggcatgtcagtgatcttcacaccagcctctcccaccacag
ACCCGGAGGCCTGGGAGGGAAAAATGGTTTCATGGGCCCTGTGCAGCCCCAGGACTTGGC
ATCCTGCATCCCAGCCACTCCAGCTCCAGCTGCAGCTAAAAGGGGCCAAGGTACAGCTCA
GGCCATTGCTTCAGAGGGTGCAAGTCCCAAGCCTTGGCAACTTCCACTTGGTGTTGGGAC
TGCGGGGGTGCAGAAGACAAGAATTGAGCTTTGGGAGTCTCCACCTAGATTTCAGAGTAT
GTATGAAAATGCCTGGATGTCCAGGCAGAAGTCTACTGCAGGGGTGAAGCCCTCATGGAG
AACCTCTACCAAGGCAATGCAGTTGGAGCCCCCACACAGAGTCCCCACTGGGGCACTGCC
TAGTGGAGCTGTGAGACGAGCACCACCATTTTCCAGACCCGAGAATGGTAGATCCACCGA
CAGCTTGCACCATGCACTTGGAAAATCCACAGGCACTCAACACCAGCCCATGAAAGCAGT
TACAGGAGCTGTACCCTGCAGAGCCACAGAGGCAGAGCTGTCCAAAGCCATGGGAGCCCA
CCCCTTGCATCAGCATGCCCTGGAT
gtgagacatggagtcaaggaagattttggagctttaagatttaatgactgcccggccagg
tttcagacttttgcatggggcctatggcccctttgttttggccaatttttcccatttgga
atggaaactcaatggctgtatctccattgtatcttggaagtaactaacttgcttttgatt

 1.04 Intr +  44392  44463   72  0  0   59   70    87 0.608   3.60
tggtgtgcaggcacagggcaatgctgaacacactcagatatgtgttgtcccaggtgctac
tcccgtcactgtcacccgtaggtactgacatgagtttggggtgtatctgaagagcctgtg
ataaagtcgggggaggctgagtatacccagtcatgccctggtgcattttgtacctgacag
CTCCTCACAGCTGCTGGGACACACTCCGAGCACATCTCACAGGGTGTGGACGACTGCCAG
GAGGAGGGGCTG
gtgtgtccttggagtcaccagaaacttggcagccctccctaatgtcagattccttcatgt
ctgaggactagtgctgccagtactagtgcagagaatggagtcagaaaatgcaatcaagtc
attagtttgcttgaactgtcttttattttgaggaagggtcaaatggaagcataggataga

 1.05 Intr +  46762  46961  200  0  2   47   81   109 0.613   4.25
ttccacatgcattcacctcagtttaccctctgagaaatgagtgagcaggaaaacctgtct
ccctgttttggaagcaacgtaactgaggtgcagtgggtggaaatggtatgcaaggttata
ggctcagaggaattctagtctctgctcagccccgggctggcatccagccctctgccccag
CCTGAGGTGTGCTGCGGAGCAACACAGAGCATCCTGGAGAAAGGAGGGGTGCTCAGCCCC
ATGGATTCATCTCCCCCAAACTGGAGAGCAGACACCAGCCACCAAGAAAGAGCCAAGAAA
GGATGGCTGCTGTTACTCAACACACCAGGCCACGGAAAATACGCGGAGTCTTCGCTCTGG
ACATTCTGTTGTGCTCGGAA
gtgagtcctcccaagcccgtggtgactgccccatgtcacactggttctggataattcgga
ctagtcaccacctgccccagcaatctctttttcaaaaagtttgtccagggcttcggtagt
aacatcagctctttcaccttggaaaaaaggcacagggtagagagatgaatacggtgtgat

 1.06 Intr +  47795  47939  145  2  1    4   43   107 0.253  -1.92
ccgggaaggcatggtctaatcccaggattaggagcagggagaaaatccatctattgaatc
gttcaaaacaaacaaacaaacaaaaatcctacccgctcaaacttaaaagactgggagcct
gaaaatgtttttgttgctgctgttgagttttcttagcgcgcctcctcctgaagttctcag
GGCACGAACCTTCGTGAGAGTCCAGATGGCCAGGGTGGTGCCTGGGAGCGAAGCTGGCTT
CGTGGTAAAAGGAGAGGCGGGAACAGGAACGCGCTGGAACCGCAGGGCTCCCGCCGTCTT
GAAAGGCCTCTGGCGTGGAAAGCAG
gtggcggaaccgcccgcctcacggcctcactcagcgcagactcacaaaatgaaggcacca
tttatgtcttctagaacgggagggagacggggacgctggcccctgccgtcgccgtggttc
atcgtggttcacctggcctccccgggaacttgccaactgccacaggtccacaggggtggg

 1.07 Term +  50247  50366  120  2  0  107   38    94 0.693   4.77
ccacgcactgagattcccactactccctgggctcatagtggcttcaaaggggcagctgag
gtggggagtgggaggcaagggctgcagagtaggaggcacgtgggccggctcggccatgga
ggagccacacgtgctttgccagcccccatacgtcctccctccctgcaccttccccttcag
ACCATCCGAGCCATCCTGGGAGGCTCAGCCTCCACCACCCATGTGGGCACCTTCTGCATT
ACCTACAATAGCCAGCCTGAGAGGAGCAGCAAGCCCTCTGCAGGCCCTCGGGACACGTAA

taatggcagtcatctttaccgcctcttcacgtcattgcctgcggcagctctgtgctattt
tagactctattgatcctggtgccaataaatggttcatattcttcaacttccttaacttag
aggctatcgtctcagtcaaattgatgtcttctgtctggctgacatagcttgggattctag

 2.01 Init +  54218  54261   44  1  2   69  115    87 0.833   7.40
gaaggagagcgtgggaggccggggaaggagagtagcgctgggtgggcagggagcccgcag
ccagctctgtggctgcctcccagacacaggcagttgccagcaccttgcctcccgccatgg
aagagcttgtgcccatggagctgagtgggccagccacagcctctcccctccctgtccgtg
ATGCGGTCAACCCAGGCGTGGCAAGCCCTGCTGGGCCAGGCCAG
gtaagcacgctggaggggccacagacaaaagggacatccgtcctacagactttaaaaggt
aactccgaaccatcaggcctgccaaggcttcccacagccacctggcctcagctgcttccc
acagatatgaggtgtggccctttcagggagaagcttttggaagaggtagcaccgtcacag

 2.02 Term +  54386  54683  298  2  1   73   47   186 0.753   7.74
tccctgtccgtgatgcggtcaacccaggcgtggcaagccctgctgggccaggccaggtaa
gcacgctggaggggccacagacaaaagggacatccgtcctacagactttaaaaggtaact
ccgaaccatcaggcctgccaaggcttcccacagccacctggcctcagctgcttcccacag
ATATGAGGTGTGGCCCTTTCAGGGAGAAGCTTTTGGAAGAGGTAGCACCGTCACAGTCAA
GGGGGGCCCAACTGGGTGGAAGAATGGGAAGTCCCGGAGGCTGGACCATCTGCCAGCCGA
GGCAGTGACTCTGCTTCTCCTAAAGGTGGTGACCAGTAGGGAGGACGGCCACCTTCTTCC
TGCAGTGGGCACTGTCTGTGCTCTGGAGGCAGCCGTGATGACAAGTATAGACAGTCAAAG
CCACACCACCAAGGGTGAAGGCCATTCCAAGAGGCGAGCAGCTCAGAGAGGAGACTGA
gtctaggggaggacggctaggaaagggggccaaacttgtatataatgatgtcttccatgt
ctggctccctggacagataaaggcccaatagagcagggaccctatctgtctggcaccgtc
cttagggcctataagattgccacatagtagcagctccacagctctttgttgaataaatga

 3.01 Init +  59559  59609   51  2  0   78  103    67 0.990   6.94
atgggtacagcttcagcttcatgtctgcttttcttttaggatgtatagtttcccctctgt
ttgctggaaggcaccttatatccagtggggttaaataaaggtagccagacccccggctgg
ggtgctaccgccagtgcccagctaatgacgcatgtctttcaggtgagcccttgggagagg
ATGGCCCATGTGGGGGACTGCACGCAGACGCCCTGGCTCCCCGTCCTGGTG
gtaagtggtctgagccccttacccccacagcaccctcatcctcatgatggttggactgtt
tcttggcctcttcagctgtaaaatgggaatgctgatcatagtccctcctccacagggttc
ttctgagggtgaaatgaaaccaggcctgcaaagcacagaactctgccccaggctgaagtt

 3.02 Intr +  60331  60453  123  0  0   73   95    85 0.894   8.48
caggagccactggagacttagcagcagtgagcactcacaagcgggcaccttcccagaccg
agcccccagcagagcccccaccgcagggcacccccttcctatgtcaaccttggggtcttg
caggagtcacatgtgtttctaaggaggtacggaggccacaacacccccctttgttggcag
GTGTCTCTGATGTGCTCAGCCCGAGCGGAATACTCAAACTGCGGTGAGAACGAGTACTAC
AACCAGACTACGGGGCTGTGCCAGGAGTGCCCCCCGTGTGGGCCGGGAGAGGAGCCCTAC
CTG
gtaaggacccagccctcctggagcctggtgcgctctcaggggaggcctcctgcttgtggc
attgttgccctgagcctgccttgctgtgtgaggggatgccagggtatatcaaaccagccg
gtcacgctccctggacgttgagattgatggcaagagctgccgtgagcccaggaatggcac

 3.03 Intr +  61194  61375  182  2  2   85   94   292 0.993  28.17
agcccagagcatgagctggttcctggggggttttgcagttaggacaactcaggaaaccaa
ggcccggcaagagtagcttctggagacagctggcacgtcactgcccaaggactgtgggcc
gagtccgtatggtttggctgctgcactcacctgtgtcccctgtcctctttccctggacag
TCCTGTGGCTACGGCACCAAAGACGAGGACTACGGCTGCGTCCCCTGCCCGGCGGAGAAG
TTTTCCAAAGGAGGCTACCAGATATGCAGGCGTCACAAAGACTGTGAGGGCTTCTTCCGG
GCCACCGTGCTGACACCAGGGGACATGGAGAATGACGCTGAGTGTGGCCCTTGCCTCCCT
GG
gtaagcacaggccctcctggcaaaccctggcatgctttctgcagaaaaccccgaggggct
acgggcaaggaccttgggaacaggggtcatggatactgcaggcctcggtgcagccgcaca
cctggccttggtcccatcccacaaggagcagcatccaggacggagagtcctggcccctcc

 3.04 Intr +  67120  67205   86  1  2  124   82    91 0.976  11.56
ttcaagacaggctgaaaccccaaggaaactgagtggacagagcaggtgactgagtgggcg
tggcctcatgcccgacttgattgtgggcctgcagactggccaccgtgctctctgcaccag
tccctgcctgtgtgctgtccagctcacctgtctctgttttgtcttgtctctcccccgtag
CTACTACATGCTGGAGAACAGACCGAGGAACATCTATGGCATGGTCTGCTACTCCTGCCT
CCTGGCACCCCCCAACACCAAGGAAT
gtgagtgtctttgtccttccaccagcacggtatttgttcagcacggatccctttcactac
agagggtgtaggaaagagccggtcctggcacctggacaaggtgaatcacagtaacagcac
tagtgaaagtgctcctgtggcctgtccaggcaggtctatgaagggagggatgtttgccac

 3.05 Intr +  77809  77895   87  2  0  109  100    32 0.871   6.44
aataacgatgactctttagggttcattaaacagtctaagaaatacaaatatttagctccc
ctcagccatcactgcctcaggcccattcatgatcatgaatccagatccatgagctctgtg
gcagcgtctttgaaggtggagcttctctggatcatttgagggactctattttccttgcag
GTGTGGGAGCCACTTCAGGAGCTTCTGCCAACTTCCCTGGCACCTCGGGCAGCAGCACCC
TGTCTCCCTTCCAGCACGCCCACAAAG
gtgaggagggtgctcaggtatcgatcacctggagttaggtggtactcggatgaaagctca
gaagaggagaggaaatgatcatgagtgatgattatggtgcgcttccccacctggcctcac
ctccctaatgtaattgaatgacatgttgccccccgtgcaggaagtcattatatctgcaat

 3.06 Intr +  79501  79626  126  2  0  113   66   269 0.992  27.85
tctggcagccaaaaccagcgcggaggatttggttctcagtctaagcaagcacctcagatt
tcagggttccctgaaagcatcccaggggcagggccattgcttccaggggccggagtcctg
gagggaagaccagcagggatcctgagctctgggtcattcatgccttctctccacccacag
AACTCTCAGGCCAAGGACACCTGGCCACTGCCCTGATCATTGCAATGTCCACCATCTTCA
TCATGGCCATCGCCATCGTCCTCATCATCATGTTCTACATCCTGAAGACAAAGCCCTCTG
CCCCAG
gtgacggcccccatgcgccggtgccctgcttcctggactctccgtcaactccccctgtcg
gagagcctggctgctcactccctcctctctccccagcctgttgcaccagccacccgggga
agagcgtggaggcccaagtgagcaaggacgaggagaagaaagaggccccaggtctgtgaa

 3.07 Intr +  79723  79797   75  2  0  112   62   115 0.992  10.79
caatgtccaccatcttcatcatggccatcgccatcgtcctcatcatcatgttctacatcc
tgaagacaaagccctctgccccaggtgacggcccccatgcgccggtgccctgcttcctgg
actctccgtcaactccccctgtcggagagcctggctgctcactccctcctctctccccag
CCTGTTGCACCAGCCACCCGGGGAAGAGCGTGGAGGCCCAAGTGAGCAAGGACGAGGAGA
AGAAAGAGGCCCCAG
gtctgtgaaccagggcttccacacaccatgtgcacggtgcccatctctgggtggagggcg
ttcccagaagcagcctcctcgctgcttctgctctcacatgctgaaccatactgtgcttac
cgtggggtggtgccacacagacaccgggcagctctgcccaacaggaagagcagggttggg

 3.08 Intr +  80041  80113   73  2  1   98   87   127 0.892  12.06
ccagaagcagcctcctcgctgcttctgctctcacatgctgaaccatactgtgcttaccgt
ggggtggtgccacacagacaccgggcagctctgcccaacaggaagagcagggttgggctg
agcgcagagccatgagccaattctaactcctatctccccaacctccccatttccctgcag
ACAACGTGGTGATGTTCTCCGAGAAGGATGAATTTGAGAAGCTGACAGCAACTCCAGCAA
AGCCCACCAAGAG
gtatgtggaagcccccagcaccaagctgaagctggggtcctgtggatcctgagcagggag
gggaaccagggtgcagccgagtgaactgacaggctagcctgggacactatggggacgttc
ggcgacagacagtccccaccacctctttgctgactggcaggggtcaggtggtgtgaggag

 3.09 Intr +  82554  82713  160  0  1  130   60   256 0.538  26.99
gtatgtctcgtctcatgtcccctggtcccgtgcccacaaggtgcccagtaaacacctgaa
aaacaagtcattgccccccactgtccacagctgggcaatggacaagttcaccacaggaga
acttgtcagggctgcagcccccccaggcactgctaatgaccatcgctcttgtttttgcag
CGAGAACGATGCCTCATCCGAGAATGAGCAGCTGCTGAGCCGGAGCGTCGACAGTGATGA
GGAGCCCGCCCCTGACAAGCAGGGCTCCCCGGAGCTGTGCCTGCTGTCGCTGGTTCACCT
GGCCAGGGAGAAGTCTGCCACCAGCAACAAGTCAGCCGGG
gtgaggctcctgcaggtgccatgatgagctgtgagatgtggctccctcacagccgcaaga
ctaaaactttcttattgaatcagctctcctgcaagacggggtgtttctcccagaagtcca
agataggagacctggacagtgacaagttcacagcaagatagtcaaaagggaaaaaaaccc

 3.10 Intr +  84205  84265   61  0  1   71  121    96 0.787   9.51
ggaaaacctgaagaaggccctcctccctgtgtgtcagggctgggctgctgacacgggggc
tgtgtgcagcgtctctggtgttgggcgtagctgctgcctgcccctgctgacatggaggat
ttgcctcctttctactgttgcccctttctggagatgaaaattctcgactctttttcacag
ATTCAAAGCCGGAGGAAAAAGATCCTCGATGTGTATGCCAACGTGTGTGGAGTCGTGGAA
G
gtaagctgaaaaaaaagcctgggagaggtggtgcccaccccaccgacatgaagggctggg
cccggagccctgaggctcctgtgaggggaactgagggaagccgcccatccagttgccgca
ctttggtcagaatggccgctggaaactatttcaggtgtggggaaacagaatcttgttccc

 3.11 Intr +  93344  93599  256  0  1   74   -9   402 0.400  25.60
cagcgttctaggtgtcgtttgccttaagttatgcatttgttttaggtggctttctgcatg
ttttataattttaaaaaaatttttttcaaataatttttatttcatttaaataatttttca
gtgttgaccttctattgactgtgacttgcaacatctaactgtggccattggtgtctgtag
GTCTTAGCCCCACGGAGCTGCCATTTGATTGCCTCGAGAAGACTAGCCGAATGCTCAGCT
CCACGTACAACTCTGAGAAGGCTGTTGTGAAAACGTGGCGCCACCTCGCCGAGAGCTTCG
GCCTGAAGAGGGATGAGATTGGGGGCATGACAGACGGCATGCAACTCTTTGACCGCATCA
GCACGGCAGGCTACAGCATCCCTGAGCTACTCACAAAACTGGTGCAGATTGAGCGGCTGG
ATGCTGTGGAGTCCTT
gtgtgcagacatactggagtgggcgggggttgtgccacctgcctcccagccacatgctgc
atcctgaaaagcatgcctgtgggctgtcctcccaggacaagccaaggagccaacgagggc
tctggagctgtgagtggtgccaaaagactgccaagaatcaaggcttttgtgatatgtcac

 3.12 Intr +  94860  94909   50  0  2   83   91    37 0.074   1.82
ttcaagagcatctaagacttgtggattagcctcatggcatgagagtttcagactcagcct
tctgagccagtcagggaaagtggagttctgcagcgcaaatgagagcctgggcttgatgtc
gagggagctggcttctagttgtgccaccttgggccttgtcttttcctctctctgcctcag
TTTCTCGTCTGCCAATGAGATGTTAGTTAGTGATTCTATAATTGGGGCAG
gtagggttcaggtgagcaaaaagaaagtggagctataggaaatgccaggcctttgaggtg
ctctatggaagtcaacacagtgtggtttgtccatttaaatgggaataaaaacagaaaaac
tcagacttggcattttcacaataactgcaatggtttgacataacatttataggcagaaag

Predicted peptide sequence(s):


>EDAR_1|GENSCAN_predicted_peptide_1|464_aa
MPLFSISEKTEDYGKQVGRKEPYRGRCTCGGSPACTTLRAHASLTHFTVNQTYCSKHSRK
ARLHLTSITKRAVQPSACKSDVGSGNQELYLPLKRAWLPGGLGGKNGFMGPVQPQDLASC
IPATPAPAAAKRGQGTAQAIASEGASPKPWQLPLGVGTAGVQKTRIELWESPPRFQSMYE
NAWMSRQKSTAGVKPSWRTSTKAMQLEPPHRVPTGALPSGAVRRAPPFSRPENGRSTDSL
HHALGKSTGTQHQPMKAVTGAVPCRATEAELSKAMGAHPLHQHALDLLTAAGTHSEHISQ
GVDDCQEEGLPEVCCGATQSILEKGGVLSPMDSSPPNWRADTSHQERAKKGWLLLLNTPG
HGKYAESSLWTFCCARKARTFVRVQMARVVPGSEAGFVVKGEAGTGTRWNRRAPAVLKGL
WRGKQTIRAILGGSASTTHVGTFCITYNSQPERSSKPSAGPRDT

>EDAR_1|GENSCAN_predicted_peptide_2|113_aa
MRSTQAWQALLGQARYEVWPFQGEAFGRGSTVTVKGGPTGWKNGKSRRLDHLPAEAVTLL
LLKVVTSREDGHLLPAVGTVCALEAAVMTSIDSQSHTTKGEGHSKRRAAQRGD

>EDAR_1|GENSCAN_predicted_peptide_3|444_aa
MAHVGDCTQTPWLPVLVVSLMCSARAEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSC
GYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGY
YMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSG
QGHLATALIIAMSTIFIMAIAIVLIIMFYILKTKPSAPACCTSHPGKSVEAQVSKDEEKK
EAPDNVVMFSEKDEFEKLTATPAKPTKSENDASSENEQLLSRSVDSDEEPAPDKQGSPEL
CLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRML
SSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIER
LDAVESFFSSANEMLVSDSIIGAX