GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:50:03

Sequence DUSP2_1 : 4662 bp : 62.42% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1143   1674  532  2  1   10   83   819 0.957  66.94
gtaacaccttcccttcccttagtcgctggtccccgcctcctcccggtgtgttggtccccg
cgccctgccttccccctcaacctcccccccgccccgaagtctccaggtcagcccagactg
cgccccacgtgaggggcgggggcgggcgcgggcgccagcgccttcctgctctgcccttgt
ATGGTGCCCCGGAGGCCGGCCCACGGGTACTTAACCCGGGCCGCCGCGGAGGGCGCCCGG
AGTCGACCGCTCGGGCAGCGCCACCGCCACGAGAGCCCGGGACGCGGGAAAGACCGAAAG
GAAGAGGAAGAGGCACCGGTGGCCATGGGGCTGGAGGCGGCGCGCGAGCTGGAGTGCGCG
GCGCTGGGCACGCTGCTGCGGGATCCGCGGGAGGCGGAACGCACGCTGCTGCTGGACTGC
CGCCCCTTCCTGGCCTTCTGCCGGCGCCACGTGCGCGCCGCGCGGCCAGTGCCTTGGAAC
GCGCTGCTGCGGCGCCGCGCGCGCGGCCCTCCTGCCGCCGTTCTCGCCTGCCTGCTGCCC
GACCGCGCGCTGCGGACGCGCCTGGTCCGCGGGGAGCTGGCGCGGGCCGTGGTGCTGGAC
GAGGGCAGTGCCTCGGTGGCGGAGCTCCGGCCCGACAGCCCGGCTCATGTGCTGCTGGCC
GCGCTGCTGCACGAGACCCGCGCGGGGCCCACTGCCGTGTACTTCCTGCGAG
gtgagcaagccggccgcccttggcccgccccacccgactccagcccggctttccctgctg
atcgtgctcttcccctccttgcaggaggcttcgacggcttccagggctgctgtcccgatc
tgtgctctgaggcccccgcccctgcgctgccgccaacaggggacaaaaccagccgctccg

 1.02 Intr +   1759   1880  122  2  2  139  109   180 0.999  26.59
tggcggagctccggcccgacagcccggctcatgtgctgctggccgcgctgctgcacgaga
cccgcgcggggcccactgccgtgtacttcctgcgaggtgagcaagccggccgcccttggc
ccgccccacccgactccagcccggctttccctgctgatcgtgctcttcccctccttgcag
GAGGCTTCGACGGCTTCCAGGGCTGCTGTCCCGATCTGTGCTCTGAGGCCCCCGCCCCTG
CGCTGCCGCCAACAGGGGACAAAACCAGCCGCTCCGACTCCAGGGCTCCTGTCTACGACC
AG
gtgagtattgacccccctcccccgaacctccctctctccccgccgcggactgggcgcctc
tagggaaagagcctgccatttggggatgcgagcagtttgcccatatacacacacttttat
acgtgtgtgtgttgggggagggggtggggcatggctgctcgcgcgtgcctgtatgggtct

 1.03 Intr +   2268   2487  220  2  1  120   87   443 0.999  46.50
gcatgaagggaaatgtatgtcccggtgtgtcctccgcacattcctgagacctgtctcagg
tcaggaggactggctgaggagtcctcttgtctcggccagcccatggggtctccacccgct
gctgctccagctctccggggctgggctggaaaggcctcaccgcccctctgttccctccag
GGTGGCCCTGTGGAGATCTTGCCCTACCTGTTCCTGGGCAGCTGCAGTCACTCGTCAGAC
CTGCAGGGGCTGCAGGCCTGTGGCATCACAGCCGTCCTCAACGTGTCCGCCAGCTGCCCC
AACCACTTTGAGGGCCTTTTCCGCTACAAGAGTATCCCTGTGGAGGACAACCAGATGGTG
GAGATCAGTGCCTGGTTCCAGGAGGCCATAGGCTTCATTG
gtaagggggcacctctgcccagaaatcccgaggggctccagaggagaggactgggggcac
ctgtctcctgggctgtgcacattccgtctgacaccactcccccatctcccttgcagactg
ggtgaagaacagcggaggccgggtgctggtgcactgccaggcgggtatctcgcgctctgc

 1.04 Intr +   2604   2803  200  1  2  138   53   222 0.901  23.98
cctgtggaggacaaccagatggtggagatcagtgcctggttccaggaggccataggcttc
attggtaagggggcacctctgcccagaaatcccgaggggctccagaggagaggactgggg
gcacctgtctcctgggctgtgcacattccgtctgacaccactcccccatctcccttgcag
ACTGGGTGAAGAACAGCGGAGGCCGGGTGCTGGTGCACTGCCAGGCGGGTATCTCGCGCT
CTGCCACCATCTGTCTGGCATACCTCATGCAGAGTCGCCGTGTGCGGCTGGACGAGGCCT
TTGACTTCGTTAAGCAGCGCCGGGGGGTCATCTCCCCCAACTTCAGTTTCATGGGGCAGC
TGCTGCAGTTTGAGACCCAG
gtgctgtgtcactgaggtggtgcccctctgcctgcctgccccactgtgctggcaggagct
gactgtggactggtgggctcccctctgggccagcacagtcccctcacctctggcagggct
gctacctcctcagagtttcagaagcccccacatgggggctctaggaatgccggcatgctg

 1.05 Term +   3088   3156   69  0  0   83   54    55 0.753   0.45
cacctctggcagggctgctacctcctcagagtttcagaagcccccacatgggggctctag
gaatgccggcatgctggtctttccgacctggtgctcttctgctgggggactgaggctggc
cctcattcggggtcgggaaccaagggtgtgtctgctctttccctccccatcctctggcag
AAATCAGCTAGACGCTATACCGTGGACTCTCCCTGGTCCACCACCATGTTGAAGCCCTTG
GCAGCCTGA
gagctccaaggaacaagctgtgacaaccaggagccctgtctgtgggttcgtctgcccagg
gcctggagcccaagccctgtgttcctggggaagctggggacttgggaagtgatgggtgtg
tcatgttgcgtgtgtctgtctgtgagcctttcacacctgtgctggcgctggaaaattatt

Predicted peptide sequence(s):


>DUSP2_1|GENSCAN_predicted_peptide_1|380_aa
MVPRRPAHGYLTRAAAEGARSRPLGQRHRHESPGRGKDRKEEEEAPVAMGLEAARELECA
ALGTLLRDPREAERTLLLDCRPFLAFCRRHVRAARPVPWNALLRRRARGPPAAVLACLLP
DRALRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGGF
DGFQGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQ
GLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGR
VLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQKS
ARRYTVDSPWSTTMLKPLAA