GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:34:04

Sequence DNAJB2_1 : 9924 bp : 55.74% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1659   1723   65  2  2   80   88   140 0.999  13.77
agggagcctagtcaccggccgcaagcagagcccggtgtgctccgcttccaactgggagcg
ccttccgccacccggggagggggactgctgcagccacagggtggggctcttggttctttc
cgcctgactccttctcttctgcagccccaaggaggcccgcctgacgactgaccagttgcc
ATGGCATCCTACTACGAGATCCTAGACGTGCCGCGAAGTGCGTCCGCTGATGACATCAAG
AAGGC
gtaagtgcctccgtatgcaacagaagacctctcaccctccacccgccaccaccatggggc
acttcagagtgacacctgtaggtgtctgagggaaccaggtcgttagaaagcactggggtg
cttcttccgagtgacacctgcagggaggaaagagacccctggtagagtacaaggagaacg

 1.02 Intr +   2403   2512  110  0  2  123   70   133 0.921  15.43
gagagagggtggaacttgatgaaaatatcacagcagcggcagccctagcagctggggtgg
actgggacccgggggtgaaaggacagtgataggctaatgggaaaacaggtcgttcggttc
ctgggtgggaagtgcctgcatttgtcccccgactctctcctctgcacccactttctgcag
GTATCGGCGCAAGGCTCTCCAGTGGCACCCAGACAAAAACCCAGATAATAAAGAGTTTGC
TGAGAAGAAATTTAAGGAGGTGGCCGAGGCATATGAAGTGCTGTCTGACA
gtaagggccggggtcaggcaggacccagcacatcaccccctacttcatgccccagctcac
attttcttaaagcaatgtctctgccacctagtttcctctgtgcctttttccagcctgaca
tttaagctcccccctcccacagggacagctcagtgtctgctccccagagtctggtaggag

 1.03 Intr +   3543   3596   54  1  0   87   96    86 0.946   8.74
tgtgtgaaaggctgagttgctgcctaaacctatagcccgtgtcccctgggtcccctgctg
tgcctgctttcccccgccaagtgtcagagtgtcagtctctggacaatcctttgaacgtcc
tagcctgggaggggagcccatcccagagggagggtgaaatgatctggtctctttttgcag
AGCACAAGCGGGAGATTTACGACCGCTATGGCCGGGAAGGGCTGACAGGGACAG
gtaggtggagtggtgaggcccaggaatggaggtggggcagggaggagaggggcagggcag
attcttgcaatggaggctctctcaggctcctggctgtgccttaggtgaggtcccccgctc
agggcaggatgcatgccctaagctctctcctcatcctgcctttccaggaactggcccatc

 1.04 Intr +   3764   3886  123  0  0  125   97   139 0.997  19.56
ctgacagggacaggtaggtggagtggtgaggcccaggaatggaggtggggcagggaggag
aggggcagggcagattcttgcaatggaggctctctcaggctcctggctgtgccttaggtg
aggtcccccgctcagggcaggatgcatgccctaagctctctcctcatcctgcctttccag
GAACTGGCCCATCTCGGGCAGAAGCTGGCAGTGGTGGGCCTGGCTTCACCTTCACCTTCC
GCAGCCCCGAGGAGGTCTTCCGGGAATTCTTTGGGAGTGGAGACCCTTTTGCAGAGCTCT
TTG
gtgagtggactctggaagcctctgaatggctcaacttccccctccaggcctgtccttcca
tcagctgggaggccctgaggtggaaggctgagaggggacgggaatgccacggacagaaga
ttttgtggagctgggtccagtgagagccgggacagaacctcacgtgtgccagaacccccg

 1.05 Intr +   4662   4754   93  1  0   95  131    17 0.988   7.13
aaccagtgagtgttttcgaattcaacattaaaaaggaatttataaataagcccaactaaa
aagcggaaaagaaaaaccctacccagttgcttagtggtttatacttccagacttgggctc
acacacttttgaggggaaatgtcattaccagatgactgctaatctgtttacttgttgcag
ATGACCTGGGCCCCTTCTCAGAGCTTCAGAACCGGGGTTCCCGACACTCAGGCCCCTTCT
TTACCTTCTCTTCCTCCTTCCCTGGGCACTCCG
gtaagttctgccccttcccacgtttgcaagctccgattcctggaacccctggcttgagct
tgttgcttttccaagcctgtctcctgtgttgggagccctgcctccagcagccctgcgagg
cggcctggagcctcggtgaccacaacaggcagcgcagtcttcttctaaccacctctcctc

 1.06 Intr +   4958   5060  103  0  1   61   94    71 0.948   4.73
ttgcaagctccgattcctggaacccctggcttgagcttgttgcttttccaagcctgtctc
ctgtgttgggagccctgcctccagcagccctgcgaggcggcctggagcctcggtgaccac
aacaggcagcgcagtcttcttctaaccacctctcctcctcctcccttgtcccgatgccag
ATTTCTCCTCCTCATCTTTCTCCTTCAGTCCTGGGGCTGGTGCTTTTCGCTCTGTTTCTA
CATCTACCACCTTTGTCCAAGGACGCCGCATCACCACACGCAG
gtgagagctccttctggggccatagaggggtgagaggtctgctggggagctgtgttcaaa
tagaaagttggctccttgagggcagggcccagtctgcgctctctactgcggtggccagaa
ctgggaccagcgcctgcaggattctgtcactgctcgttgcctgaactgtgctgtctccca

 1.07 Intr +   5244   5314   71  0  2  106   77   124 0.953  12.42
agagctccttctggggccatagaggggtgagaggtctgctggggagctgtgttcaaatag
aaagttggctccttgagggcagggcccagtctgcgctctctactgcggtggccagaactg
ggaccagcgcctgcaggattctgtcactgctcgttgcctgaactgtgctgtctcccacag
AATCATGGAGAACGGGCAGGAGCGGGTGGAAGTGGAGGAGGATGGGCAGCTGAAGTCAGT
CACAATCAATG
gtgaggagcagctcccctacccagcccctggcaggaagccccagccccaacctcagcagc
ctcctccccaaactgctgctctctgaactcacttagggcttgggagggagtggcaacagg
ccagactggtaggatcagagatggcaatgtcgggaagggggtgaaggagtctcacgaagc

 1.08 Intr +   6457   6660  204  2  0   92   80   248 0.961  24.10
tctacctggtagagctgaatacttccttgtgctcaaaatcacaagcctaggtgccaaaat
gcatgtgtgccaattccaaataagagactctaagtggtcagggttgttactgtgtgaggc
agcctggcagtaatacccctggctcaggttggggcctcatggtggctgtgactcttgcag
GTGTCCCAGATGACCTGGCACTGGGCTTGGAGCTGAGCCGTCGCGAGCAGCAGCCGTCAG
TCACTTCCAGGTCTGGGGGCACTCAGGTCCAGCAGACCCCTGCCTCATGCCCCTTGGACA
GCGACCTCTCTGAGGATGAGGACCTGCAGCTGGCCATGGCCTACAGCCTGTCAGAGATGG
AGGCAGCTGGGAAGAAACCCGCAG
gtgggcgggaggcacagcaccgacggcaggggcggcccaaggcccagcaccaagatccag
gcttgggggggacccaggagggtgcgaggggtgaagcaaccaaacgcagtccatccccag
aggagaaggcctctcgctgcctcatcctctgaacaccgggcccaacctgatctgatccag

 1.09 Intr +   8344   8459  116  2  2   14   28    91 0.115  -3.63
tggggagattttgtcttttgatttatccctgtagggctggcagggttgtagatgaagggg
gaatgatctgagccttggttcccctgacacgtcttgctagccccagggttagagtgggca
gggcagagccgcgcagcacctgggagcggtacctttcccttgggcagcctggggtcccag
GAACAAGCCAGGGCGAGTGGCATGTCTGCCTGAGCAGGGTGTGGCCCCAGAAAGCTGAGG
AGTGTGGGCTGGCAGAGAGCTTCGAGGGCAAGGCCACCCGCGGGGGCGTGTGTGTG
gtggggcttggcatgtgatggcagctccaggcatgccgctgcttgtatggctttctttgg
cctctgaccctgctgcccattctttccaacatcacagatgaactgcctctcctcctccct
gcctggggagcccagtggccagggaggggagtggtggagccagtcgctgtaacactgagc

 1.10 Intr +   8834   8898   65  1  2  129   91    41 0.291   6.51
aaaaccagctgggctgagctcagatccagggggaaatgctggaagtcaataaaactgagt
tttgagagcttggtggtgtgttgtgttcttgggttcctactttccggggtggcccaggag
ggcctctaagggacagtgggtgacacctcaggcctcacacctccctttatgcccctacag
CTAGAGGTGCAGGCCTTGCCAGTTGAAGGCAGAAATGCCCTCTTTGACCAGGCTGCCCTC
CCCAG
gtatgttatggaaccccaagcaatgcttcattctttgctttcacctcttgggggcctaca
actggctttccctagcagccgatgttccccttatgagtggcctcaccccctagtactcca
cagcacagctaggaccatactcaagttaagacttaactgaggctgggcgcggtggctcac

Predicted peptide sequence(s):


>DNAJB2_1|GENSCAN_predicted_peptide_1|335_aa
MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH
KREIYDRYGREGLTGTGTGPSRAEAGSGGPGFTFTFRSPEEVFREFFGSGDPFAELFDDL
GPFSELQNRGSRHSGPFFTFSSSFPGHSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRIT
TRRIMENGQERVEVEEDGQLKSVTINGVPDDLALGLELSRREQQPSVTSRSGGTQVQQTP
ASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGTSQGEWHVCLSRVWPQKAEECGLAE
SFEGKATRGGVCVLEVQALPVEGRNALFDQAALPX