GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:36:51

Sequence DCTN1_1 : 22082 bp : 52.09% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2001   2033   33  2  0   94  114    18 0.920   4.99
ctgcccccacccctacccgtgtaggccaccgagtgaggcccatggactggggagggctgt
gcctgacgactcctgtgtccctctatgagggcccagcgccctgaccctcctgcctaggtt
tctaccttttctctctgtctttggccagctgggggagggggtagaggccgggtgagcaac
ATGGCACAGAGCAAGAGGCACGTGTACAGCCGG
gtaagtggccctaatctgggatggccctggagggctgctggggaaggcctggctgcctgt
ggacatcattgctgtgggggctggggagataggctggagctcagctgagggcactcagac
tgtgttttctaaggagccctcgaagccctggtggtgtaaggctggacaggcttcccttta

 1.02 Intr +   3793   4038  246  0  0  119   66   210 0.942  20.09
atatcattggcattttttcaaaggggaatttgggggtccacccaattctgtaaatggggt
ttaagaaaatgactctggttgtttttcagtccagcatcttggctgaggcatttcttatac
ataagaatgccacctttgatctgaggcctctaactgtctgtgtttacctgtgtctttcag
ACGCCCAGCGGCAGCAGGATGAGTGCGGAGGCAAGCGCCCGGCCTCTGCGGGTGGGCTCC
CGTGTAGAGGTGATTGGAAAAGGCCACCGAGGCACTGTGGCCTATGTTGGAGCCACACTG
TTTGCCACTGGCAAATGGGTAGGCGTGATTCTGGATGAAGCAAAGGGCAAAAATGATGGA
ACTGTTCAAGGCAGGAAGTACTTCACTTGTGATGAAGGGCATGGCATCTTTGTGCGCCAG
TCCCAG
gtattcacgcccttcttttgtgtctgtgcatgtgtgcacatgtctgtcgcatgtgcagct
gatgtgttggtacttcgttttcctgagcatgggcataagcctctggttgggagagtggaa
ggtagtgggggagggaagattgaagatgcatccttagggaagctgccctgtactcttggt

 1.03 Intr +   4312   4390   79  0  1   40   77    61 0.262  -0.18
cataagcctctggttgggagagtggaaggtagtgggggagggaagattgaagatgcatcc
ttagggaagctgccctgtactcttggtttgcttggagcctggggaggggcccatattaca
gccgtccttgatctggctatattgaaactattgatctggctatattgaatctggcctcag
ATCCAGGTATTTGAAGATGGAGCAGATACTACTTCCCCAGAGACACCTGATTCTTCTGCT
TCAAAAGTCCTCAAAAGAG
gtaacaaccacccacttaaagttgcctccccatagccaggaggagtccccaggacttctc
ctcataacatggggccacagtagatcctaagatttttttccgtcactaccatattccctt
attatatctccccctacctctctatacaagtacacactttgtttctgtttgctttctaca

 1.04 Intr +   9090   9110   21  1  0   94  100    20 0.203   1.80
agtaggaatacagtgattcactgaagggagaaggggatgggatgggggggagggtggcta
actgtagccccattcctgttatttcttctgctctcattgctgtcccttttgctctctgtc
tttctgccattgtcctttctttcctgactacttctcttctggctcctgttgcctgtccag
ACCACAACTCGGCGACCCAAG
gtgagaaaacaggcccctgtgtgagccactgctgagtgtacacacacgtttcaggcatgt
ggatgtatgagggcacgtgtatgagcaagtgaaagttcgtcatagtgtatcctgggttct
cttcagaggaaagggtgggggttcgcagtgctggcaggcacctcctggggaaaatggctt

 1.05 Intr +  10374  10501  128  1  2   33  116    24 0.511   0.60
tgctttttcccttttctgtctccttcccttgccatattctcatattctgtttctgttcct
cttactacccctatcctctgctttctttctggtctgcctctaccctttctgaatagccca
cgcgcccagccagtactggggtggctggggccagtagctccctgggcccctctggctcag
CGTCAGCAGGTGAGCTGAGCAGCAGTGAGCCCAGCACCCCGGCTCAGACTCCGCTGGCAG
CACCCATCATCCCCACGCCGGTCCTCACCTCTCCTGGAGCAGTCCCCCCGCTTCCTTCCC
CATCCAAG
gtaaggcctggggtaggggtaaaggagaatcaagacacccagaggcttgtggctacccgc
tgtgtcttgaaaatttcctggggttggcaaagacctagaacttggatcagaaagggtgag
gacatagcctatggatatcttgctactgactgagccatcctttcctttcttgcccttatg

 1.06 Intr +  10862  11059  198  1  0   81   42   249 0.795  19.67
ccatactttccccatatatactgtgctacggtttcctctcagatgttcttatgccactga
ctgttggccaccctggggctgggtgatgtttgcacactttcttgtgttctttgcgccagc
tcagtgttggtggagaggaggagtgggctgtgcacagaccgtgaggcctctcctttgcag
GAGGAGGAGGGACTAAGGGCTCAGGTGCGGGACCTGGAGGAGAAACTAGAGACCCTGAGA
CTGAAACGGGCAGAAGACAAAGCAAAGCTAAAAGAGCTGGAGAAACACAAAATCCAGCTG
GAGCAGGTGCAGGAATGGAAGAGCAAAATGCAGGAGCAGCAGGCCGACCTGCAGCGGCGC
CTCAAGGAGGCGAGAAAG
gtttgactctggatgaagggggtggctggggcagcctgagacctaaggaagcatgctgga
aactagactggagctggagcctggaacatactgtgagaaaggcctggggcatctctgtgc
tggtaccccctcccacctccacttcttcctcaggaagccaaggaggcgctggaggcaaag

 1.07 Intr +  11213  11417  205  1  1  114   86   395 0.969  41.20
cagcggcgcctcaaggaggcgagaaaggtttgactctggatgaagggggtggctggggca
gcctgagacctaaggaagcatgctggaaactagactggagctggagcctggaacatactg
tgagaaaggcctggggcatctctgtgctggtaccccctcccacctccacttcttcctcag
GAAGCCAAGGAGGCGCTGGAGGCAAAGGAACGCTATATGGAGGAGATGGCTGATACTGCT
GATGCCATTGAGATGGCCACTTTGGACAAGGAGATGGCTGAAGAGCGGGCTGAGTCCCTG
CAGCAGGAGGTGGAGGCACTGAAGGAGCGGGTGGACGAGCTCACTACTGACTTAGAGATC
CTCAAGGCTGAGATTGAAGAGAAGG
gtaaggggcccacagctgctgggggccaaacggtcaggtgagaaccatgcctgaaagtgt
taatgatcttctccaggctcagatggcgctgcatccagttatcagctcaagcagcttgag
gagcagaatgcccgcctgaaggatgccctggtgaggtagggtcttcagtgcttgcctctg

 1.08 Intr +  11494  11572   79  2  1   60   75   119 0.957   6.90
agagcgggctgagtccctgcagcaggaggtggaggcactgaaggagcgggtggacgagct
cactactgacttagagatcctcaaggctgagattgaagagaagggtaaggggcccacagc
tgctgggggccaaacggtcaggtgagaaccatgcctgaaagtgttaatgatcttctccag
GCTCAGATGGCGCTGCATCCAGTTATCAGCTCAAGCAGCTTGAGGAGCAGAATGCCCGCC
TGAAGGATGCCCTGGTGAG
gtagggtcttcagtgcttgcctctgatgcttactcttgtgtctccaaatgtgttagagca
cccatcgccagagactctgacacgtgctttcctccttctgccttcctcacatccctgcag
gatgcgggatctttcttcctcagagaagcaggagcatgtgaagctccagaagctcatgga

 1.09 Intr +  11693  11852  160  2  1  101   41   265 0.999  23.60
cagttatcagctcaagcagcttgaggagcagaatgcccgcctgaaggatgccctggtgag
gtagggtcttcagtgcttgcctctgatgcttactcttgtgtctccaaatgtgttagagca
cccatcgccagagactctgacacgtgctttcctccttctgccttcctcacatccctgcag
GATGCGGGATCTTTCTTCCTCAGAGAAGCAGGAGCATGTGAAGCTCCAGAAGCTCATGGA
AAAGAAGAACCAAGAGCTGGAAGTTGTGAGGCAACAGCGGGAGCGTCTGCAGGAGGAGCT
AAGCCAGGCAGAGAGCACCATTGATGAGCTCAAGGAGCAG
gtctggggagcccagcccctcacccagaatcccccacctgactctcctatcagttgatgc
ctcctctttctaggtaccttccagcagcccttctccctatcctccccgtaacacaggtgg
atgctgctctgggtgctgaggagatggtggagatgctgacagatcggaacctgaatctgg

 1.10 Intr +  11969  12073  105  1  0   93   91   138 0.998  15.51
gcgggagcgtctgcaggaggagctaagccaggcagagagcaccattgatgagctcaagga
gcaggtctggggagcccagcccctcacccagaatcccccacctgactctcctatcagttg
atgcctcctctttctaggtaccttccagcagcccttctccctatcctccccgtaacacag
GTGGATGCTGCTCTGGGTGCTGAGGAGATGGTGGAGATGCTGACAGATCGGAACCTGAAT
CTGGAAGAGAAAGTGCGCGAGTTGAGGGAGACTGTGGGAGACTTG
gtaagagaagagcagacccctgacatctgacttggacctgctgagaaaaagattgacatg
tgacccttggcctttgagcagggtgtgcggtgagggacccagcctgggcttgctaccctg
accctgccttttttttttttttttttttctgagatggaatctcgctctgttgccaggctg

 1.11 Intr +  12547  12738  192  0  0   50   88   347 0.999  31.11
ccagctaatttttgtatttttagtagagatggggtttcaccatgttggccagcatgatct
cgatctcgacctcatgatccgcctgctttgacctcccaaagtgctgggattacaggtgtg
aaccaccgccgctggccgaccctgcctttctttagcccaaactatggtgtggtgtcctag
GAAGCGATGAATGAGATGAACGATGAGCTGCAGGAGAATGCACGTGAGACAGAACTGGAG
CTGCGGGAGCAGCTGGACATGGCAGGCGCGCGGGTTCGTGAGGCCCAGAAGCGTGTGGAG
GCAGCCCAGGAGACGGTTGCAGACTACCAGCAGACCATCAAGAAGTACCGCCAGCTGACC
GCCCATCTACAG
gtacatgcccactgtttgctctctgcccaccatcaccccagggcttccttatgacccagc
tgtgcttcactgtctctcctcctaggatgtgaatcgggaactgacaaaccagcaggaagc
atctgtggagaggcaacagcagccacctccagagacctttgacttcaaaatcaagtttgc

 1.12 Intr +  12824  12940  117  1  0  136   77   153 0.981  20.17
gtgaggcccagaagcgtgtggaggcagcccaggagacggttgcagactaccagcagacca
tcaagaagtaccgccagctgaccgcccatctacaggtacatgcccactgtttgctctctg
cccaccatcaccccagggcttccttatgacccagctgtgcttcactgtctctcctcctag
GATGTGAATCGGGAACTGACAAACCAGCAGGAAGCATCTGTGGAGAGGCAACAGCAGCCA
CCTCCAGAGACCTTTGACTTCAAAATCAAGTTTGCTGAGACTAAGGCCCATGCCAAG
gtcaggaaagtgtgtgggtctgagggagccctgcctgggatgaactggtatggggtctgg
gcttcagattcctgggggaaggggtgctttgtgtggtggtttggaagactctggcctggg
cttgccctagaagcaagggatctactggagcaaggcatgggaattttggggctctttcag

 1.13 Intr +  13158  13254   97  2  1   88   75   106 0.445   9.38
ggatgaactggtatggggtctgggcttcagattcctgggggaaggggtgctttgtgtggt
ggtttggaagactctggcctgggcttgccctagaagcaagggatctactggagcaaggca
tgggaattttggggctctttcagctctggctaagagtcctcctccctgttcacctcacag
GCAATTGAGATGGAATTGAGGCAGATGGAGGTGGCCCAGGCCAATCGACACATGTCCCTG
CTGACAGCCTTCATGCCTGACAGCTTCCTTCGGCCAG
gtggggaccatgactgcgttctggtgctgttgctcatgcctcgtctcatttgcaaggtat
ggccaatcaatcacatgttccacagaaatctagtgaacttgccatgaaccaggcattgaa
gatgctgagtgaagacaacagagtctctgcccacaaagagtttatggtatagtggaggaa

 1.14 Intr +  13311  13420  110  1  2   52   35    79 0.436  -0.50
gagtcctcctccctgttcacctcacaggcaattgagatggaattgaggcagatggaggtg
gcccaggccaatcgacacatgtccctgctgacagccttcatgcctgacagcttccttcgg
ccaggtggggaccatgactgcgttctggtgctgttgctcatgcctcgtctcatttgcaag
GTATGGCCAATCAATCACATGTTCCACAGAAATCTAGTGAACTTGCCATGAACCAGGCAT
TGAAGATGCTGAGTGAAGACAACAGAGTCTCTGCCCACAAAGAGTTTATG
gtatagtggaggaacacagcaaagtcaccgattaatatatattacaaatggtgtgttttc
aaggagagataggttctgtgagagagcacaattagagatttgatttagaggtgagcaggg
tgtgactgagggaataacattgtctgagggccaggaggtgcctaggggttaaccttgggg

 1.15 Intr +  13907  14067  161  1  2   97   92   274 0.996  28.00
gtaatcacatcactaccctttccccatgcaagattccccacccaggtaagagctatttct
gctttctctcccatgtgtgtccatgctccccacatagttaagctctgagtactatattcc
tgagtctctgttctccatcctctgctctgaggcccaggttcctggtgctttttcccacag
GCAGAGCTGATCCGGAAGCAGGCCCAGGAGAAGTTTGAACTAAGTGAGAACTGTTCAGAG
CGGCCTGGGCTGCGAGGAGCTGCTGGGGAGCAACTCAGCTTTGCTGCTGGACTGGTGTAC
TCGCTGAGCCTGCTGCAGGCCACGCTACACCGCTATGAGCA
gtaagtgactcctgactccctcaccccagggtgggggtccaggattggccagaactgaga
ttgcctggcagactctagcctcacagtgcccttctctggtctctagtgccctctctcagt
gcagtgtggatgtgtataagaaagtgggcagcctgtaccctgagatgagtgcccatgagc

 1.16 Intr +  14174  14342  169  2  1  101   64   255 0.975  24.86
gagcaactcagctttgctgctggactggtgtactcgctgagcctgctgcaggccacgcta
caccgctatgagcagtaagtgactcctgactccctcaccccagggtgggggtccaggatt
ggccagaactgagattgcctggcagactctagcctcacagtgcccttctctggtctctag
TGCCCTCTCTCAGTGCAGTGTGGATGTGTATAAGAAAGTGGGCAGCCTGTACCCTGAGAT
GAGTGCCCATGAGCGCTCCTTGGATTTCCTCATTGAACTGCTGCACAAGGATCAGCTGGA
TGAGACTGTCAATGTGGAGCCTCTCACCAAGGCCATCAAGTACTATCAG
gtgtggggcaagaatttgggcttggggcaggaggcagggaagctttcacttgatgggggc
tcttactaatatattcaaggttgtatgtcccatgcttgctgcttgaggcctggtttgctc
ttagatgaactctccatatgatgcagctgcttgagggctttggattctcttgtacctcca

 1.17 Intr +  14618  14686   69  1  0  100   67    88 0.995   7.77
ttgctgcttgaggcctggtttgctcttagatgaactctccatatgatgcagctgcttgag
ggctttggattctcttgtacctccagagacccatgatgaccagggctcaaactacagttt
gggaagaactccccacccgctccagggcctaaaagttgtctgtctgttatctctcctcag
CATCTGTACAGCATCCACCTTGCCGAACAGCCTGAGGACTGTACTATGCAGCTGGCTGAC
CACATTAAG
gtgaagtatctgggccagtgattgagcccccgtggagatcagaaatggagggcatcaggt
caagagatcaggcacccaagaagtgtcacataagactagggcagagttaccaaagccata
tcagggaaactagaggacctacttatgtatgggggtcagcagaggatggggacttcttag

 1.18 Intr +  14931  14993   63  2  0  100   94    30 0.909   4.21
agatcaggcacccaagaagtgtcacataagactagggcagagttaccaaagccatatcag
ggaaactagaggacctacttatgtatgggggtcagcagaggatggggacttcttagagat
gttgataaggcagaagggctcctgctgggggctgatgattgcatgcttctatcctcacag
TTCACGCAGAGTGCTCTGGACTGCATGAGTGTGGAGGTAGGACGGCTGCGTGCCTTCTTG
CAG
gtgagaacacatctagatctgtgtgagctcctcttctttcttagtcctcacttccttact
ccgagccttaatgctaacttggttctccatccattttctttttcctgagtagggtgggca
ggaggctacagatattgccctcctgctccgggatctggaaacttcatgcagtgacatccg

 1.19 Intr +  15106  15255  150  0  0   43   14   209 0.998   9.87
cacagttcacgcagagtgctctggactgcatgagtgtggaggtaggacggctgcgtgcct
tcttgcaggtgagaacacatctagatctgtgtgagctcctcttctttcttagtcctcact
tccttactccgagccttaatgctaacttggttctccatccattttctttttcctgagtag
GGTGGGCAGGAGGCTACAGATATTGCCCTCCTGCTCCGGGATCTGGAAACTTCATGCAGT
GACATCCGCCAGTTCTGCAAGAAGATCCGAAGGCGAATGCCAGGGACAGATGCTCCTGGG
ATCCCAGCTGCACTGGCCTTTGGACCACAG
gtttaaggctgcaactggggaagggaaggaaactgagtagaaacatgaagggtatagcac
ttgaagatctggatctggttaggggacaaaaatggttttggggtagctggaaactgtggt
gctgaacccagggttgactcctgactctggcctggcacacaggtatctgacacgctccta

 1.20 Intr +  15418  15579  162  0  0   80   80   151 0.900  14.19
ctggcctttggaccacaggtttaaggctgcaactggggaagggaaggaaactgagtagaa
acatgaagggtatagcacttgaagatctggatctggttaggggacaaaaatggttttggg
gtagctggaaactgtggtgctgaacccagggttgactcctgactctggcctggcacacag
GTATCTGACACGCTCCTAGACTGCAGGAAACACTTGACGTGGGTCGTGGCTGTGCTGCAG
GAGGTGGCAGCTGCTGCTGCCCAGCTCATTGCCCCACTGGCAGAGAATGAGGGGCTACTT
GTGGCTGCTCTGGAGGAACTGGCTTTCAAAGCAAGCGAGCAG
gtgggcctggatggctgggtagaaggtgtggggagagttagtgaccagtgtggggctttt
acttctgcccttggctcctgcagatctatgggaccccctccagcagcccctatgagtgtc
tgcgccagtcatgcaacatcctcatcagtaccatgaacaagctggccacagccatgcagg

 1.21 Intr +  15663  15794  132  2  0   91  100   217 0.999  24.55
ggcagctgctgctgcccagctcattgccccactggcagagaatgaggggctacttgtggc
tgctctggaggaactggctttcaaagcaagcgagcaggtgggcctggatggctgggtaga
aggtgtggggagagttagtgaccagtgtggggcttttacttctgcccttggctcctgcag
ATCTATGGGACCCCCTCCAGCAGCCCCTATGAGTGTCTGCGCCAGTCATGCAACATCCTC
ATCAGTACCATGAACAAGCTGGCCACAGCCATGCAGGAGGGGGAGTATGATGCAGAGCGG
CCCCCCAGCAAG
gtaggtggagatttccttggagaagttgcagaggcctgtaggagtaagacttgcagagct
actgctagttgtgggaggacggggagacaggaggaaggcatctggagagcaccatcctgc
ctagaaggcagggttttccctgtaactggatctctctgtaaggagcacagtgatgatctc

 1.22 Intr +  16020  16145  126  2  0   76  100   129 0.970  14.28
aagacttgcagagctactgctagttgtgggaggacggggagacaggaggaaggcatctgg
agagcaccatcctgcctagaaggcagggttttccctgtaactggatctctctgtaaggag
cacagtgatgatctcttctctccaccctcactttctcaccccctaccgaccattccttag
CCTCCACCGGTTGAACTGCGGGCTGCTGCCCTTCGTGCAGAGATCACAGATGCTGAAGGC
CTGGGTTTGAAGCTCGAAGATCGAGAGACAGTTATTAAGGAGTTGAAGAAGTCACTCAAG
ATTAAG
gtgagggtagtgtaggctcaggatctgggggccaggaaattggtaggactcaggaaagca
gtgagtgttggggatcgggaccaagacggcttgggagttaaggggagaagtggggcctgc
aatcaatgggagctgtggtgagccctcagggaacctactatctcatggtctagcccccag

 1.23 Intr +  16381  16523  143  0  2   47   -2   277 0.994  14.26
aagcagtgagtgttggggatcgggaccaagacggcttgggagttaaggggagaagtgggg
cctgcaatcaatgggagctgtggtgagccctcagggaacctactatctcatggtctagcc
cccagtttccagggactgtggggaggatgtcagggatctagaagttctgtccttgtccag
GGAGAGGAGCTAAGTGAGGCCAATGTGCGGCTGAGCCTCCTGGAGAAGAAGTTGGACAGT
GCTGCCAAGGATGCAGATGAGCGCATCGAGAAAGTCCAGACTCGGCTGGAGGAGACCCAG
GCACTGCTGCGAAAGAAGGAGAA
gtcaggcactttccctggggccttgcttcctctaatcctcccactgctggagctctctgc
ctcctaacccatacccctactcaggttctcttatagtgagactccccattttctttaccc
actgccaaccccattgcatcaccccagcctaagcctgtgctgctctgccctggcttctca

 1.24 Intr +  16797  16963  167  0  2   26   89   210 0.994  15.02
tagtgagactccccattttctttacccactgccaaccccattgcatcaccccagcctaag
cctgtgctgctctgccctggcttctcactggcagggctattccaaggacctctcaggact
gaatagtcaaggagtgctttagagaagggacactgccaaagcccagattctctttcacag
AGAGTTTGAGGAGACAATGGATGCACTCCAGGCTGACATCGACCAGCTGGAGGCAGAGAA
GGCAGAACTAAAGCAGCGTCTGAACAGCCAGTCCAAACGCACGATTGAGGGACTCCGGGG
CCCTCCTCCTTCAGGCATTGCTACTCTGGTCTCTGGCATTGCTGGTG
gtgagtactgtggaataggcagcactagcacagaggagattgtcttctctcctgtccttg
gcctcattttgacctctgccccaccccccttacccccgggtattcagccaggaacatgct
tacacagtttcactctgtgccagttttcaccaagttttcccttccgctgaagatgtgtgc

 1.25 Intr +  18611  18744  134  0  2   93  100    64 0.997   8.97
acccactctggccgggggttaccaggctggtgggagttggagctaagggagcagggtgga
gggggaagccaggactggagatgggtgatggggggatgaggaaaggggaagagtaggaat
ggagcccaattttcaaccctttccacttggggctgatgagattttttatggtccccacag
GAGCCATCCCTGGGCAGGCTCCAGGGTCTGTGCCAGGCCCAGGGCTGGTGAAGGACTCAC
CACTGCTGCTTCAGCAGATCTCTGCCATGAGGCTGCACATCTCCCAGCTCCAGCATGAGA
ACAGCATCCTCAAG
gtgagggagccacggggaggactgggatgggagatggagcatatttgccccattgatgat
agatgacaggggcctcctagcacctcttaccactatccttcttttttcatccacagggag
cccagatgaaggcatccttggcatccctgccccctctgcatgttgcaaagctatcccatg

 1.26 Intr +  18861  19044  184  2  1  123   84   109 0.998  13.88
tcagcagatctctgccatgaggctgcacatctcccagctccagcatgagaacagcatcct
caaggtgagggagccacggggaggactgggatgggagatggagcatatttgccccattga
tgatagatgacaggggcctcctagcacctcttaccactatccttcttttttcatccacag
GGAGCCCAGATGAAGGCATCCTTGGCATCCCTGCCCCCTCTGCATGTTGCAAAGCTATCC
CATGAGGGCCCTGGCAGTGAGTTACCAGCTGGAGCGCTGTATCGTAAGACCAGCCAGCTG
CTGGAGACATTGAATCAATTGAGCACACACACGCACGTAGTAGACATCACTCGCACCAGC
CCTG
gtatgtacctgccaacccccaagatgaataaaactgccccctccacttggcccagggatt
tagcccctgctcaggtggttcccccaccacagaagctcttcccagcagtgttctttggct
tcactgttcagtttgtttgattcacccactctctctcaagtacttgttctgttagagagt

 1.27 Intr +  19309  19388   80  2  2  121   82    99 0.997  12.37
caccacagaagctcttcccagcagtgttctttggcttcactgttcagtttgtttgattca
cccactctctctcaagtacttgttctgttagagagtcttatacctgcacccctaaccctt
aatccagtagaactgcctgcctgcgccttggtgggcctcaccagctttctctccccacag
CTGCCAAGAGCCCGTCGGCCCAACTTATGGAGCAAGTGGCTCAGCTTAAGTCCCTGAGTG
ACACCGTCGAGAAGCTCAAG
gtcagctcagtttgccaggcagagctcacttcacagcataaactggtggagccaggcact
tgtggagttcctctgagcccagccctgtgctagacagcaattggggaggagatggaaggg
aaggcagggttcttgccttggaagctcactgtctcagtgcaaacagaagacagattctca

 1.28 Intr +  19897  19986   90  0  0  135   72    63 0.999  10.09
tgcaaagtaaggaggagtgctggtgtggggatggggttggagatgagagcaaaagtatgt
tgatatagaggactaagtccctgcccccctggtattagtgtctctgtgaaaccacgtggt
cttgtgctagcctgtgggggtcccataaatgaacccttgtcttcctctccccttccctag
GATGAGGTCCTCAAGGAGACAGTATCTCAGCGCCCTGGAGCCACAGTACCCACTGACTTT
GCCACCTTCCCTTCATCAGCCTTCCTCAGG
gtgagggggagcatggggtggaggatgggacagtgtggagagctcaggcgggcccccctc
tcctccagaattggaggaggcctttggagtctcaggtctaacaactgcataccttgggtt
atctggccaaattttacttacaagtaactcagaagtgcttacagtgctttgaaattccaa

 1.29 Term +  20402  20539  138  1  0   60   47   208 0.528  12.17
tcccttgtcagattatgtatccccattcttatttgaaaaatgtggtcacaatagcccagg
atctcagaagccctagtcacccaggagctgccttggtctcagtgctcagggaccccttca
gtggcccacagctcaagtgagcccctgacctggagtctttttctcctcatcaaccaccag
GCCAAGGAGGAGCAGCAGGATGACACAGTCTACATGGGCAAAGTGACCTTCTCATGTGCG
GCTGGTTTTGGACAGCGACACCGGCTGGTGCTGACCCAGGAGCAGCTGCACCAGCTTCAC
AGTCGCCTCATCTCCTAA
gcactcctttcccctgctgtccccttcgaccctcagccctctggtgccgctctgcccgat
gcacagccacctcagccagcccccaggtagaaacgtgggttaagctcttcctgccccgtt
cagcttcactcccaccctttcagcgtcctgccccttcaccttgacccgggttcccccact

Predicted peptide sequence(s):


>DCTN1_1|GENSCAN_predicted_peptide_1|1245_aa
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGV
ILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPETPDSSASKVLKRD
HNSATQASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEGLRAQVRD
LEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARKEAKEA
LEAKERYMEEMADTADAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEI
EEKGSDGAASSYQLKQLEEQNARLKDALVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVR
QQRERLQEELSQAESTIDELKEQVDAALGAEEMVEMLTDRNLNLEEKVRELRETVGDLEA
MNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETVADYQQTIKKYRQLTAH
LQDVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMS
LLTAFMPDSFLRPGMANQSHVPQKSSELAMNQALKMLSEDNRVSAHKEFMAELIRKQAQE
KFELSENCSERPGLRGAAGEQLSFAAGLVYSLSLLQATLHRYEHALSQCSVDVYKKVGSL
YPEMSAHERSLDFLIELLHKDQLDETVNVEPLTKAIKYYQHLYSIHLAEQPEDCTMQLAD
HIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETSCSDIRQFCKKIRRRMPGT
DAPGIPAALAFGPQVSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEGLLVAALEE
LAFKASEQIYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRA
AALRAEITDAEGLGLKLEDRETVIKELKKSLKIKGEELSEANVRLSLLEKKLDSAAKDAD
ERIEKVQTRLEETQALLRKKEKEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGL
RGPPPSGIATLVSGIAGGAIPGQAPGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSI
LKGAQMKASLASLPPLHVAKLSHEGPGSELPAGALYRKTSQLLETLNQLSTHTHVVDITR
TSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATVPTDFATFPSSAFLR
AKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS