GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:19:48

Sequence CREB1_1 : 71296 bp : 38.02% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    421   1257  837  0  0   71   97   466 0.774  40.53
agaatggggacctagtggtgccgtcctgagagacctctgaaagaacaattcagtagtttc
cagccacggaagtccccctgctgggtttagggtgcagtgggtgcgaatccctgctgtaga
aaacaggctgaggaaagaaagcgacacaggatgttgtctggagaaaggcggggaggtagg
ATGGGGCATATTTCCAGGGGTCCGGGCAGGTTGTGTGGCTTGGAGGCCTCCGAGGGCCGT
CGACGTCAGCCATGGTCCGGGCAGAGCCCCGCAAGGTGCCACAGTATCGGGGCCAGCGCC
CCCCGGAAAAGCATGCTCCGCTGGCGGCCGCCAGGTTTCTCCGCGGAGTCTCGGAAAGGA
AAACCCGTCCCCACGGGGGTCCCACGACGCCCCCGGGTCCCAGGCCCCGGGACGTTGGCA
GAGGCGCAGCAGACCTTCTTCCCCAGCCCGCACGGCTCCAGCGGTCCGGCCGCGTCCCAG
CCCGGGCTGCCCGTCCCCCGTCTCCCGGCGGCGTCGGAAAGTTCCCGGGGCTGGCGGCGG
TCAAGAGCAGAGCCAGGGCAGCCGCAGCCGCCTTCTAGCCCGCCGCTCACCGCCGCAGGG
GCAGGCCTGAGCGGGGGTTTCCACCAAGTCGCCGACACCCCTCGGGAATTCCCCCACTGG
GCCACACACAAACCCCGCTTCCTCCTTCAAATTTCCGCTGCCGGCTTTACCGATGCGAAA
GCCGCGGTGGAGTTTAGACCACTCCTCCCGGCGCCGGGCTCAGCCCGCCTTCGCCTTCCC
TCTCCCCGCGGAACCCCTTCTCGTCGCCCGAAGAAACCCGAAGGTCTTCGGCAAGTTCCG
TCCCCAGCGCGGGGGCGGGGCCGCTCGAGCTGCTCCGGGCCTAGCTCGGCTGTTTCCGTG
CGCGGCCGCTGCGCACTCGGCACTGGGCGGCGCTGGCTGGCTCCCTGGCTGCGGCTCCTC
AGTCGGCGGCGGCTGCTGCTGCCTGTGGCCCGGGCGGCTGGGAGAAGCGGAGTGTTG
gtgagtgacgcggcggaggtgtagtttgacgcggtgtgttacgtgggggagagaataaaa
ctccagcgagatccgggccgtgaacgaaagcagtgacggaggagcttgtaccaccggtaa
gaggagcaggaggaggaggcaggagccagagagagccggggggacggaggggggacgggg

 1.02 Term +   1887   2120  234  2  0   -1   55   171 0.888   0.24
gcgcccgcgttcccgccgccgccgccgggccgggcgcggagccgggaacccggagccgcc
ccgggggaggccgcccgctcggcccggcgctgccccccgcgccgctcgctcgtccggccc
ccgccgcccgcctcgcccccggcccgacccggccgggcctccggggcagccgccgcctag
GTGCCGGTGGGGGATGGAGGAGGAAGAAGGCGACAGTTGAGGGCAGAGGAGGTGAAGGTG
CCTGCTGCCTTCCCGGTGGCTTCGGTGCCTGCCATGCCCGCTTCGCAAGGGGAAGAGCTG
CAACGTCTGACCTACTCTTCTCTCCACTCTTTGTGCAATAAAGTTCGAAACCCAAGGTTT
CCTCTCGTGCTGTATTTTATTCGTGCCCTTTCCCCCCCGCTCCTACACCGTTGA
ggaaatgctgctttctgccctgtgttgcttagttgagagatgagagcttgtgcttttggg
gggaatttttgactccctcacccctttgctttttttttttttttaaagtcagtcatggaa
atgcatgctttttgggagaaagggtgctaagaaaaacatttataataactttttaaactg

 2.01 Init +  26881  26988  108  0  0   78   75   133 0.867  11.27
ataagtttgatggtaattcagctacattatattttagctagatttctgagttcatttggt
aacctaaccaccacatatatacctatttataacttgaaatttgcctttaaagtcacgaaa
gcacaaagcactgtggtgcttgtaacactcttccatattattataggtaactaaatgacc
ATGGAATCTGGAGCCGAGAACCAGCAGAGTGGAGATGCAGCTGTAACAGAAGCTGAAAAC
CAACAAATGACAGTTCAAGCCCAGCCACAGATTGCCACATTAGCCCAG
gtataaaatacatggagagattccagtttgtgtctcttcctagaggaatacgtttccaag
agaatttagttgttattacatagatatacatagaatgagcagagatactcttacaatatc
aaaattcctatttacttagtattagagtatatttagaaatgatagtattaattcaataac

 2.02 Intr +  31465  31611  147  0  0   87   91   140 0.998  13.71
gtgttttttatagtgttttttcttaaagaatattaaatttagtcattactttcatatcag
tgaaatacatatctagcaaaaaggtcacgtttttgcttctaaaaagttatttcatattga
acatgagtactgccaaagagtgtctgggatgataattcttttctgtgttcaacaccatag
GTATCTATGCCAGCAGCTCATGCAACATCATCTGCTCCCACCGTAACTCTAGTACAGCTG
CCCAATGGGCAGACAGTTCAAGTCCATGGAGTCATTCAGGCGGCCCAGCCATCAGTTATT
CAGTCTCCACAAGTCCAAACAGTTCAG
gtatgtgtataaaaagttctgcatctattttaataacttttgtttatagccatatctctc
tcctttcactagttatgaaaataaggacacatctagttcagtttattttattcacagtat
aggaatatgctgcatctgtatagtcaccttatgtataggaacatatatacagaagaacaa

 2.03 Intr +  32358  32399   42  2  0   89  109    26 0.826   2.32
gggtttgatccacaggtaataaaggcactgtagacctttgaaggtgactactctgtttaa
ctgtagggaaccgagagcagtatagatcattgcaattgagcttattgaaaaaaaagactt
gaacgttcattcaagtaggccataaccccagcctcccatttcatattttttgcttcacag
TCTTCCTGTAAGGACTTAAAAAGACTTTTCTCCGGAACACAG
gtgagtcctaggtcctagatttggagagaactattattagaaaggaaggtgagaaattat
tctttatgtctttgtccttttcctctataaacatggaatttcaacacttgaacaaaaacc
tcagagatcttctgggtctaggccatacttgttacctccccagcccttagtctgttgctt

 2.04 Intr +  38702  38802  101  1  2   76   80    61 0.993   2.09
gtagtttatagggtaagtaaagggaaggggaaagtgattggtgtggttgtctcccataag
aactgatttttttctactgaagcatgtataaagtttatatatgactttttatatttgttt
aataaaaattttacaggaactaaatttgattatcaatatgaagtttttctttaatttcag
ATTTCAACTATTGCAGAAAGTGAAGATTCACAGGAGTCAGTGGATAGTGTAACTGATTCC
CAAAAGCGAAGGGAAATTCTTTCAAGGAGGCCTTCCTACAG
gtatggaatttaatagttagaatcaaagatgtggaggaagtcttaggtagttgcagataa
agagatgtcagaagaccagttagttgttcacgtcagttccttatagattacttttcttca
tcttgagttatttgtctcaaataaagtggaagcttatcctacagaataagaagagcactt

 2.05 Intr +  41418  41560  143  0  2   85   73   145 0.915  11.78
gccactgcactccagcctggcgacagagcaagactccatctcaaaaaaaaaaaaaaaaaa
aaaaccttctgtcctaagcactagcagctttctgtgagttttctcatctttaactatatt
tgtatttagccagtaaattgtacttatatttttaattattctagttttctaattttgtag
GAAAATTTTGAATGACTTATCTTCTGATGCACCAGGAGTGCCAAGGATTGAAGAAGAGAA
GTCTGAAGAGGAGACTTCAGCACCTGCCATCACCACTGTAACGGTGCCAACTCCAATTTA
CCAAACTAGCAGTGGACAGTATA
gtgagtaatagacaatttctgtttctattgtgaggagaaaaaagtgaggagaaaaagcta
atagttgcattctcttcagagaaaccaatacaagtgccaagtcttctcagttttgctgcc
attattatatttcctttactcttcactatgcaaaggtctgtaatggtagtattttctttt

 2.06 Intr +  46511  46693  183  0  0   25  116   161 0.775  11.44
tagaagttgaatatgggtttcctgaggagcaagttacttgaatatattagacccttcttg
gtgatgttatttgctgtaacttctcctagattattttacaaattattctacattggatgt
aatgttttaaaagtcttatatggtattaaacttgtaacaataaaatccattggcttttag
TTGCCATTACCCAGGGAGGAGCAATACAGCTGGCTAACAATGGTACCGATGGGGTACAGG
GCCTGCAAACATTAACCATGACCAATGCAGCAGCCACTCAGCCGGGTACTACCATTCTAC
AGTATGCACAGACCACTGATGGACAGCAGATCTTAGTGCCCAGCAACCAAGTTGTTGTTC
AAG
gtaagggaattcagaattcacaggtgtggtaaattcttcaaaatactaaaattttataaa
ctcacagaaaaagtaagtatcatattgcaaaccaccattcaaatgtagttaacatttctt
caatattgatagtatttttcatgaactcttccattattccaattggaccaaaatgtcatg

 2.07 Intr +  48744  48894  151  1  1   79   87   192 0.914  16.50
ggaattatttcttagtagtggcgcgaagagtgctgattctttcaacgctttagccagaat
catcttttcttttttgtttcccttttagtccaaaatacatgcttagattgatgattgata
cacataattgaatcaagttgcaatgtttctgtcttacaccatgctcactgtttttttcag
CTGCCTCTGGAGACGTACAAACATACCAGATTCGCACAGCACCCACTAGCACTATTGCCC
CTGGAGTTGTTATGGCATCCTCCCCAGCACTTCCTACACAGCCTGCTGAAGAAGCAGCAC
GAAAGAGAGAGGTCCGTCTAATGAAGAACAG
gtacaaatactgcatttacttagattgttatgtgttaagtgtgtcttcacattctgctgg
atgtgtatctttacatctactggtaataggatctttgcattgaattttttttttccagca
gaattaatggatcttgctaaattttctttatttaataagctgcacttataagatagctgt

 2.08 Term +  68153  68297  145  2  1  115   28   145 0.755   7.60
gattaaaattttaatataaggtaatttccaagtaattctgtatatcttttccaatgctta
atatatactaaaatgttggttgctgtgagctatttctttaaaaaagaaaaaaaaaaggta
atccaaaataaatatgtggaaatcatttgcataatttttcccgtcctcttttgcttgtag
GGAAGCAGCTCGAGAGTGTCGTAGAAAGAAGAAAGAATATGTGAAATGTTTAGAAAACAG
AGTGGCAGTGCTTGAAAATCAAAACAAGACATTGATTGAGGAGCTAAAAGCACTTAAGGA
CCTTTACTGCCACAAATCAGATTAA
tttgggatttaaattttcacctgttaaggtggaaaatggactggcttggccacaacctga
aagacaaaataaacattttattttctaaacatttctttttttctatgcgcaaaactgcct
gaaagcaactacagaatttcattcatttgtgcttttgcattaaactgtgaatgttccaac

Predicted peptide sequence(s):


>CREB1_1|GENSCAN_predicted_peptide_1|356_aa
MGHISRGPGRLCGLEASEGRRRQPWSGQSPARCHSIGASAPRKSMLRWRPPGFSAESRKG
KPVPTGVPRRPRVPGPGTLAEAQQTFFPSPHGSSGPAASQPGLPVPRLPAASESSRGWRR
SRAEPGQPQPPSSPPLTAAGAGLSGGFHQVADTPREFPHWATHKPRFLLQISAAGFTDAK
AAVEFRPLLPAPGSARLRLPSPRGTPSRRPKKPEGLRQVPSPARGRGRSSCSGPSSAVSV
RGRCALGTGRRWLAPWLRLLSRRRLLLPVARAAGRSGVLVPVGDGGGRRRQLRAEEVKVP
AAFPVASVPAMPASQGEELQRLTYSSLHSLCNKVRNPRFPLVLYFIRALSPPLLHR

>CREB1_1|GENSCAN_predicted_peptide_2|339_aa
MESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQ
TVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQ
KRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQY
IAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVV
QAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRR
KKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD