GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:58:32

Sequence COL5A2_1 : 149647 bp : 34.66% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 PlyA -    448    443    6                              -0.45
 1.02 Term -   1127   1037   91  1  1  105   43    70 0.001   0.41
 1.01 Init -  34898  34825   74  2  2   47   87   118 0.385   8.19
 1.00 Prom -  53021  52982   40                              -3.15

 2.01 Init +  64507  64636  130  0  1   76   74   115 0.998   9.26
cagaagatgtaaaaccccataggcctaccccatacatacttatcctcccaccatcccata
gatcttgaggctgagatagaaaaaaattgtcaaagtatgtaatagatccccctcaggtat
ccctggtggcttcatatgtatctaacttttcaaatttgggagttgtttaaggaaagcaaa
ATGAGGAATGTGGAATTTTTGGCATCTCCTCTGCATGGTCTAAAGAAGGAATTGAATGCT
GTCCCTCTTCGTCTTTCCCTTCTAATGATAAACAGTGCCCTAGAGCAGAAGGAAGGGAAG
GATTTCCTTG
gtaggttctctggaaccccatccaggagcccacgctctgctgtgcattactaaaggcagc
atctgtggcatccagactgacacgtgggcggctttattacctcctcctttgtcccacaag
gcattctctctccacttcatgaggccaccagctgacagtgtcatgattatagtccctcaa

 2.02 Intr +  70514  70738  225  0  0  113   91   163 0.966  16.13
tatttcatggtgaattacatattattttgttatgaaatgaaatcagttcatctgtgtttg
gctccttggaaggttacttcttagtccagaattttttagaatccacaagatggctcacct
tttattttctcaattctataatttcagattactaacctcttctttcttttcttattttag
AAGGATATGGTGAAGAAATAGCCTGCACTCAGAATGGCCAGATGTACTTAAACAGGGACA
TTTGGAAACCTGCCCCTTGTCAGATCTGTGTCTGTGACAATGGAGCCATTCTCTGTGACA
AGATAGAATGCCAGGATGTGCTGGACTGTGCCGACCCTGTAACGCCCCCTGGGGAATGCT
GTCCTGTCTGTTCACAAACACCTGGAGGTGGCAATACCAATTTTG
gtaagaatgtttagggccaactcataattgatccagttactcacctttatagttgcagtg
tttttcactttcagcattcagcaactcaagagaataattaagcagcttttttggtggctt
ttggggttaatgattaatgattttgctcactcacttcatctaaagttagatagaagcaga

 2.03 Intr +  76686  76699   14  1  2  143  115     1 0.924   1.88
ttttgccttttatggaagtattgatccaaaaccttttgaattctgcttactgctgatagt
gtaatcactatcactgtaattctgactccagaagaaatctattattgaaagtaaatattt
agcagattctcaataattgtttcctcataaaataacacatttactcttttctttttacag
GTAGAGGAAGAAAG
gtaagtgttactttgcatattttctttttcataagcagacttatatccaatactatccac
acagaactgtgctctgaaacgtttgaaagcttttgaaaagtacaaagtaccatacaaata
cattgtgacaagtatataagcacagttcagctactgtgtttccaaaggacagatgcctct

 2.04 Intr +  83633  83686   54  1  0   74   95    32 0.497   0.76
acaacgcttctaagcgtacagaacttttatatgcacatggctttattctctatagtcttc
aactgaactgaattaagtgtggtatttctgttttccaattttcttttatcaagtagactt
ttaaaaattcaataagaaagtatacatttttgcatgcataatcatcattttctgttttag
GGACCTCCAGGATCACAGGGACCAAGAGGAGAGCGAGGGCCAAAAGGAAGACCT
gtaagttgacaggagggctccttgtggggaacgtacagccagtcagtttacactgtgttc
tctgaatgcagcaagaagctgggagcactattcctctttcacctccattaaattttacaa
aaatacaataataattgtatattatcttattagataacacaaatgatatttccttgtccc

 2.05 Intr +  88543  88653  111  0  0   93   96   136 0.954  14.56
agttcagacctatgctgaaatcagtagtgacatggctgatgaaattactctaagtggcta
gattgccatgtatttttaaaataataaacactcccttgccattaagaagtctgtgccttt
agctttctactaagtgtatatttggcagtgggttctaattttaactggcttgttttccag
GGCCCTCGTGGACCTCAGGGAATTGATGGAGAACCAGGTGTTCCTGGTCAACCTGGTGCT
CCAGGACCTCCTGGACATCCGTCCCACCCAGGACCCGATGGCTTGAGCAGG
gtgagttgtgtgcattgtttgatgtcacgtacaggtcatgttttaaattattgatatatt
gttaggattttaaattgtgtctgttcagatattgacacttgactgtaagagcagttaaat
aaggtcaacactgctatggacagtagaactaataaacccacagggaattgttggaaaaat

 2.06 Intr +  94193  94237   45  1  0   85  108    25 0.718   1.89
gtccaagctttaatctccttgaatttagctgccttccaaatgagtacagatggagaatgt
catcatccccctttgtcaaaacttcacttttccagattctagagatgattcaacattttt
gaaatatttgacctaattgtcatgagtactttgcaacgtttctcctcatttgtttttaag
GGTCCTGTTGGCCCAAGGGGACCACAGGGTTTACAAGGACAGCAA
gtaagtctctttataattaattacatgctgtaagaaaaacatacacacacacatatatta
cataaggtctctgtgacatgactgcttttggctggttttaaaattttatattgtaatgct
cacttcaaacaggatatattaaatagtttttatttagaaatatatgccacatgtctttgc

 2.07 Intr +  95191  95244   54  0  0   72   54    78 0.644   1.06
ttattctgattttacacattaggaaacagttacagacagattaagtaacttgcccaaagt
cacacagctggaagatggcagagccaactgtctaaacaattacactgtatattgacagag
tacagggtttaatattctatttttccttggtttgtatatatactttgttttcaactgtag
GGTGGTGCAGGACCTACAGGACCTCCTGGTGAACCTGGTGATCCTGGACCAATG
gtaaatgtcaagtaagcatgtagacccagttacatttgggtccaccattataatgatgtc
aaatattgagttatttatcttcccaggtcctccctaatgtaggaagaaataacaatccag
tttgggagtcctgttctatgaactgttcttaagctatatgtttctcatagcagaatattt

 2.08 Intr +  95750  95803   54  1  0   88   69    71 0.853   3.46
gatgcaacataaaattcaaaactttaataaaactattttctctgtctcaacaatatttat
cattttcatttgtttcaataatagtttgacatttcatttgtctcaataatgttttgaatt
gtattactggcaagtaaaggtaaatattctttttttccttttgttttgttctgttattag
GGTCCGATTGGTTCACGTGGACCAGAGGGCCCTCCTGGTAAACCTGGGGAAGAT
gtaagctacctttcctcattttccattcaggttttgaagaggcgaaggggttaaaatgtt
aacaagaatgttctgtattaatttccattacatttccccacccttttagcttgcattaaa
ttcaatgtaaacaggagcactcagaatggaattttacaaatatctaaaagggctcttaat

 2.09 Intr +  96926  96979   54  1  0   53  131    65 0.975   5.56
actatcaggaatataaggaatagagcctatttttactttattttttgcactgtttagaga
attgtacattagctttctaaagaagactgttttattagtaatttatttatcatttagttt
cagagaagaaccttttaatcacttttgccttcccaatctcctacatttttttccataaag
GGTGAACCTGGCAGAAATGGAAATCCTGGTGAAGTGGGATTTGCAGGATCTCCG
gtaagtttatactcaacataaaggcaaactttgaaaaataaagaacattgaattaaatca
caattctctgtatgcacatgtatcaggcactaagtaaatggagacaaacagcattgtttg
tttccgtaaaaatgtaaaatgtcacaggacgttttgccagagtgattgttaactccagtt

 2.10 Intr +  99920  99973   54  1  0  122   91    51 0.988   7.06
tgctaattttgatcacccagatatattttgacagataaaagtatactgcttttttttgtt
cttcttaatatgttgctggaaaactgtgtactagctattttttgggaaaaaatgatatat
taaggaattttgcatccttattaatgactgtaaaatgccctatctatgttttcctcccag
GGAGCTCGTGGATTTCCTGGGGCTCCTGGTCTTCCAGGTCTGAAGGGTCACCGA
gtaagttcaatctattgtaatcctctcagatactgtggtttagtgaacaggctctgggga
gatttaccttcaaaatctttacaagtcaatttgtcaattgtccttaactgtctatggttg
cagtattcatctgtggttactgaaatcacaattttttaatacatttcctttgagtttaat

 2.11 Intr + 100932 100985   54  2  0   54   84    77 0.816   2.16
tctaattttccttgaataagctttcagaaaagtttgagaatttgaaagtattttgagcaa
caactttaaatttgatattcatttttataaggcaatttctgcaagcttatttttggttct
tatgcctttgaggattgaaaaaaacaggatacaaatacaaatttacatttttattctcag
GGACACAAAGGTCTTGAAGGCCCTAAAGGTGAAGTTGGAGCACCTGGTTCCAAG
gtaatcttataattatctcactgtaacctcactttggcatcttagttttgcttcaaatgt
ttacacatttttcagaaccaccttaattcagcaggagagagggctacaaacaaatggtta
ggtaaataaacataatttttcaaagatgagtggcaatggctttaccatgacatgacttga

 2.12 Intr + 101856 101900   45  2  0  110   84    41 0.923   3.59
aactacactactattgcattttgagaagaggtaataaaacaacattctgagatcctatat
caaaagtacatctttcatatgtcctctttgaaaatatgcttttaaaattacacacacaga
acaaagtgatgtatcggttgtaggcttctcatactgtaatgtattctcatttttttttag
GGTGAAGCTGGCCCCACTGGTCCAATGGGTGCCATGGGTCCTCTG
gtatgtgctcgttttcttgtttcttaaatttctaaggttatatttccttgccttttagat
tacaacaagagaatttttaaatgaaaaataaaaataaatggacaacatatgttggctagt
aaaataatcttgattaccagctgatagacaagcacaggagagttgagcccttctaacaga

 2.13 Intr + 105526 105570   45  0  0   81  101    23 0.592   0.59
ctaccatatcagcttgtgtaaatgtatttatattgctattaactgagtgagggttattgt
cagttaactttaatatttattcttcaatttgcaatatggaaattttttataaggcaaata
agagaaaatatagtctaaaatgtaatcttatcctgtcttgtctctttttctcttaattag
GGACAACGAGGTGCACATGGTATGCCTGGAAAACCTGGACCAATG
gtgagttatattattttcatattaattcattaatttattcatgcattcttccatttgtac
attcaaaaacatttacagagcactcaccacatgccagacacttggaataaaaagttgatg
gacacatagtacttcttcaaaactgttctattaaggaagagagagatattaatattgttg

 2.14 Intr + 108870 108923   54  2  0   94  116    23 0.926   3.96
tactttagattgatgttgaaggtacttataatgaaattagcctattatctttgtaatttt
aaagtgaaaggcaggttattcttatgtgtctaatacaaaatgacgccaaactctaaaaaa
tgacctaattagatactaattgaatacatgtctgattacttttctggtttcttttaatag
GGTCCTCTTGGGATACCAGGCTCTTCTGGTTTTCCAGGAAATCCTGGAATGAAG
gtaagatgttaatgttaatatacagtatttaacgctacatgattacatgagtcccaaagt
gaagaatgacatttaattaattgaaaagtgtgaaagttacttttaactaaggaaagagcc
tagagtatgctcatttttcattattacatggaaaaagatacattaaaaaataaaattaac

 2.15 Intr + 112079 112177   99  1  0  109   95    54 0.995   7.59
gaaggaagtgggaaagtgagtgcgctccttaagcttggttgggcacgcatctcttgtaat
cctctttggcctctttcagtatttgggtttcaaatgtaaaattccaaataagcggtcaac
tttgtacaatgccactctcgtatttttcttaaattaacatttccctttgcacccttttag
GGAGAAGCAGGTCCTACAGGGGCGCGAGGCCCTGAAGGTCCTCAGGGGCAGAGAGGTGAA
ACTGGGCCCCCAGGTCCAGTTGGCTCTCCAGGTCTTCCT
gtaagtttctagcatatttaagaaccagcccagaaagctggacatttcttgtaacatcag
aacaaattcaacctatttttttaattgatacataatatttgtacatatttagggggtacc
tgtaatgttctgttatatgcctaagatgtgtaataatcaagtcagggtatttaagatatc

 2.16 Intr + 112693 112737   45  0  0   73  113    51 0.932   3.79
tttacctattttatgtaaaggagaagtagtcaaaaaagtaatttttatgatataatggtg
gttgatttttaaaaaatgcttctacttcctttttgaagatggctggacatctgtatacta
gcacatttgtatctatatattgcttaatatttcattacatacttttaatgtaccttttag
GGTGCAATAGGAACTGATGGTACTCCTGGTGCCAAAGGCCCAACG
gtgagtactgcatttatggcatgtgaagctcaaatgggcatgattctttagacattggcc
ccagactgctacctgtgtctctacttaccacatcactcttgctgtttaatagggctctcc
aggtacctctggtcctcctggctcagcagggcctcctggatctccaggacctcagggtag

 2.17 Intr + 112850 112948   99  1  0   91   52    62 0.829   2.29
catacttttaatgtaccttttagggtgcaataggaactgatggtactcctggtgccaaag
gcccaacggtgagtactgcatttatggcatgtgaagctcaaatgggcatgattctttaga
cattggccccagactgctacctgtgtctctacttaccacatcactcttgctgtttaatag
GGCTCTCCAGGTACCTCTGGTCCTCCTGGCTCAGCAGGGCCTCCTGGATCTCCAGGACCT
CAGGGTAGCACTGGTCCTCAGGGAATTCGAGGCCAACCG
gtaatgacctttgaaagaactatcatcctttagtgtaatctaactacgagggccaagagt
aataacatgtcatgtgatgcaatgaaacatagataacgtgacttatccaaatgtgggaag
atgggagtctttgtgaagtgaaagctaaatgttgaggtacaacttagatgtttaaattct

 2.18 Intr + 114466 114573  108  0  0   97   61    83 0.666   6.06
gtacagctcaaaatgctcaagggtttaaaataataatgagaattataatagcttgagatg
aaaatatctcattgttccatatactttaaaatttgtgactgacttcgttaaattaggctt
ccaactataattcactggttggatgggtctttctggtaactgtccttctgtttttaacag
GGGCCACATGGTATTCAGGGTCCGATAGGCCCACCCGGTGAAGAAGGCAAAAGAGGTCCC
AGAGGTGACCCAGGAACAGTTGGTCCTCCAGGGCCAGTGGGAGAAAGG
gtaaatttaaataatacaacacattcttacagttgtgagggaattatgtgtgtaagtctg
agaacagtaaggaaaactagaacagttaagagaaatgcttgcaggttccctgcacagttc
agtacagttatgtgcaaatagaaagagccaactgactaatcattattcatacattcaact

 2.19 Intr + 116308 116406   99  0  0   73   94    84 0.992   6.89
aggcataggggggaaggatgctagttggcggaatgtggtgacaaaattttatacgttata
tcagtgccttgatttgtatgttatattagtgccttgatttgtaaaacgataattttactt
ctgcttgcttttgtttttctatactctttttcttcatgcatctgctttgcctcggtacag
GGTGCTCAAGGAGAACGGGGTCCTGTAGGTTCTTCAGGACCCAAAGGAAGCCAGGGGGAT
CCAGGACGTCCAGGGGAACCTGGGCTTCCAGGTGCTCGG
gtaagaatatagcaagtgtttgctacatcaaaggggagaagtgctcctgagcatgcattg
gtcgggtttttgtttgtttttaaatttagtttgtttttacagtttagaacatttctttgt
ttttatggttttgatccaattcattattttaaaaaatactggtttgttatttttatcata

 2.20 Intr + 116930 116983   54  1  0   91  111    78 0.997   8.66
aaagtaattttggcagagaaattctgaaaaattttaacaatacatcacttaaaaatttat
ttgatttacagaaatgtcattctattcagttgacaaaaatgcaacactatttttactctt
aagaatctttacttcaactgcatatcagcaacaaactgacagttggttttttattttcag
GGTTTGACAGGAAATCCTGGTGTTCAAGGTCCTGAAGGAAAACTTGGACCTTTG
gtaagtaatttaaacagaagtccacaaccactaatatttttcaacagacatgcaacttaa
atgatatttatttaggttaatgtttttgattatatggatgctggtcatattgacatattt
gtaccaacttctggaagcatattcttaggatctattttcaagttgacaaaaatgtagatc

 2.21 Intr + 117693 117791   99  2  0   59   65   105 0.957   4.69
tacttaaaatacttcagtgttttttaaaaaacccattcaactgtcctgattctttaacat
gaaaatgcaagataatttaaaatttatgtaacatgatagtaagcaaaggtgacactttgg
gtgatgctatgtttagaaacaacttacatgaaacttacatggctcctgtcaattctatag
GGTGCGCCAGGGGAAGATGGCCGTCCAGGTCCTCCAGGCTCCATAGGAATCAGAGGGCAG
CCCGGGAGCATGGGCCTTCCAGGCCCCAAAGGTAGCAGT
gtgagtacagtgtataatatgttggccacctcatcatgatcctcatttggaggaggtatg
tttttgacaaattgaaggaattatacaaaagtttcatttattctttagggtgaccctggg
aaacctggagaagcaggaaatgctggagttcctgggcagagggtaaatatacattttctg

 2.22 Intr + 118045 118098   54  0  0   54   96    62 0.778   1.86
gaaggaattatacaaaagtttcatttattctttagggtgaccctgggaaacctggagaag
caggaaatgctggagttcctgggcagagggtaaatatacattttctgctaaagaaaaata
atgtaggtactatttaaattatcatagactcacctcacaaatatctgtgtgtgatactag
GGAGCTCCTGGAAAAGATGGTGAAGTTGGTCCTTCTGGTCCTGTGGGCCCGCCG
gtatgtgatttttgtgtgtgtgtgtgtgagaatatatatatacacacattgcattttttc
gatgatgtttgttcaagacttatgggtaagtttcagggaaagtgaataagaatgtatggg
aatgaagaatttctgttataccttctcttttgatttctgtgagataatgtcttctgcctt

 2.23 Intr + 119348 119401   54  1  0   55   85    57 0.559   0.36
ccagagacttcaaacaataccatttggttactattaatactagtttattacctggctaaa
gagaaaaacatgtgattggaagaaatacaaataaatatcagtacttctagtggttcacgt
agagaggaagcagacaaagatctggttatattcacaattattttctccttcacaacttag
GGTCTAGCTGGTGAAAGAGGAGAACAAGGACCTCCAGGCCCCACAGGTTTTCAG
gtatgcactaattcggttttccatttcatcttccattaactaaaatgcttttttttttta
aaaaaaaagatatggtcagaagatttgaaattctacaattttcaaaaagtcatccctctt
ttagtagatagtatagacatttggataaaatcgaacatttttgttcaaagtaaaggaatg

 2.24 Intr + 120180 120233   54  2  0   88  108    56 0.977   5.86
attggtagtctttttttaatgcttctgaacaatattttttacttaaaatgtctgaacaat
atattttcattgaaaatatagtcttggagaccccatgaattgtaaaaggtaaactgttaa
cactggtagcctgttaaacttacacagattcacaattttattttcttacttttgttttag
GGGCTTCCTGGTCCTCCAGGGCCTCCTGGAGAAGGTGGAAAACCAGGTGATCAA
gtaagtgtttaaataataataatggcaacactatacattgctggctcaattatcactttt
tatgtgtgaggctctgttgtgctttcctttacatacattatctctttgagttctcaaagc
agccctatgtactaggtactatcattatctccattttgtagatgaggaaaatggggcata

 2.25 Intr + 122436 122534   99  2  0   32  106   122 0.995   7.79
tgtgctatgaaactagcatatccttacttcaaatttatttcttatcactaaattagaaaa
ttgagatttagtaatgtctcatttctgaatttttccgcagtagaagccatttctcagaaa
cattttgacctatttttagatcaagtattgagattatttgacatcccaattttgtgctag
GGAGAACGAGGAAATCCTGGGGAAAGAGGAGAACCTGGGATAACTGGACTCCCTGGTGAG
AAGGGAATGGCTGGAGGACATGGTCCTGATGGCCCAAAA
gtaagtgtcatagtgatctcagtgttttaaaatgctttaaaattactgcttaataaacgc
atgatggtgtgagaatgcatttgtcttgtttttgaaagataatttgattatatcattttc
ttcttccacaaatatttaatgagcgcttactaggctttttccttgcaactaaagtgtcag

 2.26 Intr + 123536 123643  108  1  0   67   89   103 0.996   7.86
ctggtttttttaatttcaaaatatcaactcactcagagacaactttctcagatgaaaaat
ataagcactaagttgaactacatgaaattgctgacaactacttttgacccactaaaaagc
aatttcattagtttaatcttaatattattggtatggtcacttaatgttggttcattttag
GGCAGTCCAGGTCCATCTGGGACCCCTGGAGATACAGGCCCACCAGGTCTTCAAGGTATG
CCGGGAGAAAGAGGAATTGCAGGAACTCCTGGCCCCAAGGGTGACAGA
gtaagtcctttttttttttttttttttttcagttcatttattcagactttctgctgaaaa
tgaaatgatttcttgagcaggcttttatttctaccatcctgagtcactagtcattcattt
ttcattcttctaataaacatttactgagaaaatgcacagtgtgaggcaccatcccaggct

 2.27 Intr + 123937 123990   54  0  0   82   89    89 0.990   6.66
ttcatttttcattcttctaataaacatttactgagaaaatgcacagtgtgaggcaccatc
ccaggctcacctggatacgactaggaaaatgacaattagccttcactctcatgaaactta
cacacaagtgtgggaaagagacaattaaatgaatcaattgtattttgtgtgttttcccag
GGTGGCATAGGAGAAAAAGGTGCTGAAGGCACAGCTGGAAATGATGGTGCAAGA
gtaagtgaaagtattccttttctagctgggctaggaaccaacattacagtatcatatgag
tttccctgaaccttccaaaataaagtcagtcatgtttccttggtagtcaggagttggaga
ataatggcatgtgagatctgctgtgattcaaccacggtttattcattttgcttaccctga

 2.28 Intr + 126751 126804   54  0  0   76  115    59 0.980   5.66
ttaaactagacagaaaactcttgaaaatatatagattatatcatttattatagataatga
tttgcaaaggcagccaaattataacaaaatagtcgtttcttttttgtttgttgatttgct
aagcatgaagatttctgtgcattttttacctcaatatgcctatgttctgttaattgacag
GGTCTTCCAGGTCCTTTGGGCCCTCCAGGTCCGGCAGGTCCTACTGGAGAAAAG
gtaagtcacaagttgttaatttgtacactcaaaattatgagtcctgaatagcaggctctt
tcataaatcttttcattttataacatatggtatctgagcaagatcatttcagagttcttt
tccactatctcctcctacacagtgaccaatgtcctaaaattatgtttagctactgttttg

 2.29 Intr + 127015 127068   54  0  0   86   95    34 0.805   2.16
aaaattatgagtcctgaatagcaggctctttcataaatcttttcattttataacatatgg
tatctgagcaagatcatttcagagttcttttccactatctcctcctacacagtgaccaat
gtcctaaaattatgtttagctactgttttggacagtaaccatctaaaatctgctttctag
GGTGAACCTGGTCCTCGAGGTTTAGTTGGCCCTCCTGGCTCCCGGGGCAATCCT
gtaagtgacagtattttggtgttctttagtgtgagattgagcaataaaacaattaatcat
tttgtttttatatttatataaaacaatgcttattggttttaggttatgtataacttcctg
gtttttagcttttgcttttctaattaaacttaaaaattatctgctatacaatctattaag

 2.30 Intr + 127486 127539   54  0  0   74   75    86 0.947   4.16
ttgggaattttgttctatgacctatatctttatataatccttaaggaccttccttaagca
atatgtgtaatttttctatatttacatgtctaactatcagatttatatgatcatatttta
aaatactgttcctgtttaggataatgtgtgaaagctacagtaatctttgtctcctcctag
GGTTCTCGAGGTGAAAATGGGCCAACTGGAGCTGTTGGTTTTGCCGGACCCCAG
gtataattttcaaatatccctaatttacaaataaacacttatcttgttataataagttta
atgatcattgtcatatgttttgaagtcgtattctggaaaatttacagttttctagacaat
attctcattttcaatacatttttttatagactggcacaaaacttgtttgtgctagttgag

 2.31 Intr + 127945 128052  108  0  0   72  103   139 0.998  13.36
ttttttaggctgttttgaaagatctcatcagagtactttttttcctttagtatgctttaa
tactgattataaagcactgtttcacaatatatgattaattgatacattagtaataattac
tctaaagtaatttgtctataagtcttataatcaattgcttgtttgtataattttttatag
GGTCCTGACGGACAGCCTGGAGTAAAAGGTGAACCTGGAGAGCCAGGACAGAAGGGAGAT
GCTGGTTCTCCTGGACCACAAGGTTTAGCAGGATCCCCTGGCCCTCAT
gtaagttaacaagaaaaaggcataacttgagtcaagtgccccatgtttggagtgtacatt
cagcctcttttgcttcactatagtgctcttttgtttgtttctattcagggtcctaatggt
gttcctggactaaaaggtggtcgaggaacccaaggtccgcctgtaagtttatttgatgct

 2.32 Intr + 128161 128214   54  0  0   94   95    57 0.974   5.26
ggagagccaggacagaagggagatgctggttctcctggaccacaaggtttagcaggatcc
cctggccctcatgtaagttaacaagaaaaaggcataacttgagtcaagtgccccatgttt
ggagtgtacattcagcctcttttgcttcactatagtgctcttttgtttgtttctattcag
GGTCCTAATGGTGTTCCTGGACTAAAAGGTGGTCGAGGAACCCAAGGTCCGCCT
gtaagtttatttgatgctctgcaaagtatgcacagctaattctagttacctagtgcttcc
tggtcatgtaaaagataattttcatctgagactgaaataacaaattattacctgtatcaa
ctgtactatagtgcaaagggcacttaactcagatggagatttgggttaaaatcaagtttg

 2.33 Intr + 129482 129643  162  1  0   81   95   172 0.996  16.45
tacagctgtgttttcttttgttttgttttgtttaaatcctatagaatgactgattatcta
acaggtaaaatgaacctgcgaggcttggacatctgcatctgaggcagacagcgttatgtc
aatcactcttacttgccttccattttgccctccttggtgtttctttctttgttatactag
GGAGCTCCAGGACCTGCGGGACCCCTAGGGGAACCCGGGAAGGAGGGACCTCCAGGTCTT
CGTGGGGACCCTGGCTCTCATGGGCGTGTGGGAGATCGAGGACCAGCTGGCCCCCCTGGT
GGCCCAGGAGACAAAGGGGACCCAGGAGAAGATGGGCAACCT
gtaagtttggcgtatccgttccagaccaccttcaactgagatatttacaaatagaaaccc
ataatgatcagtgtcacaaaaatgcttaaatattatgctgggcacattcctaaaattttt
aaagtgcattaaatctataaggctttaggaaaaacgtgtatatatatagattttaaaaat

 2.34 Intr + 131509 131616  108  0  0   73   81   150 0.996  12.36
gtctgataggaggtgggcaggcctctaagaaagcattatgattacatgagtgttgtaaga
taatgcaaaattattattatagaaggagcccagaggcaccattttgaaaacttagccttt
atgggaactagcgttcttcaatttcttcacaagtgtttgacatttatacttctatttcag
GGAACACCAGGAAAAGTAGGACCAACTGGTGCAACAGGAGATAAAGGTCCACCTGGACCT
GTGGGGCCCCCAGGCTCCAATGGTCCTGTAGGGGAACCTGGACCAGAA
gtgagtactacagtgaaaataactcttctcttgttatctggtgtcatggaaacaattttt
ttcatttagcaattgatttagaattttattgcatatttgaccttaagaaagtttcttagt
aatgttatttgatgtactctacttccctagagagttggctaagtgatgacataaagaaaa

 2.35 Intr + 135056 135163  108  1  0   56  107   108 0.994   9.06
ttcttttcaatttgatttattaattaataaatataagtaaaatagttaaaataataagta
aaaataagttttaaagggtattttttcccattattaatactataagaataacatgaacat
atggaatattgttgttttagaataaatgttaaaaaataatatcatggttattcttgttag
GGTGATCGTGGAGACCCTGGGCCTGCAGGTCTGCCAGGCTCTCAGGGTGCCCCTGGAACT
CCTGGCCCTGTGGGTGCTCCAGGAGATGCAGGACAAAGAGGAGATCCG
gtaaggagggagtcaatttcacactgacagttttgcacacccatatgctatgttataagc
tgcatataggcacacacacatagtcatacatgtgcacttcgttaaggactctaaataatg
aatggtaaacagctaattatgaactactatatgtttcttagtctgaaaggcaaaatttca

 2.36 Intr + 135731 135784   54  1  0   69   95    39 0.657   0.96
tacacatggacatttgcctgatttcaattaattaatcataagagtatgcacacacacaca
cacacacacacatatatatatatgcatccaactataaacgtattgttgacatcctgtatc
tatgtaatatgtgaatatcttttttacatgccaattttttttgttgtaaatttcttttag
GGTTCTCGGGGTCCTATAGGACCACCTGGTCGAGCTGGGAAACGTGGATTACCT
gtaagttctctttttttgttttttaaaaaatgttttcttatataaaatatactcccaaag
aagtataatttaagattcataactgaaaaatatgaaattcctcaagcttgaacaaaaata
ttaattaaaaattataagtttactcttattttttaaagtaatacgagtttatttttataa

 2.37 Intr + 137705 137812  108  1  0   75   95    70 0.982   5.96
aaaaataaacagaaatttctaggtctaatactatttttagataagtaaatatattaatcc
atataaaataccaagttcaaaattgtagtaaatacaattataaaaagtaaaattttagta
aattttagtctcaacaataatatgtagcaagtaattttcatgccatatctctatttctag
GGACCCCAAGGACCTCGTGGTGACAAAGGTGATCATGGAGACCGAGGTGACAGAGGTCAG
AAGGGCCACAGAGGCTTTACTGGTCTTCAGGGTCTTCCTGGCCCTCCT
gtaagttattcctttaagtattattctgccctgtagttgaaaatacacgggtatcttgac
acgaacatttatctgtctgtaaaataggtggatatgtttgtatcttattttcagttcaaa
gaatatcttgatgaataacaagtgataattgccaataataagctataattttgtagggaa

 2.38 Intr + 138190 138243   54  0  0   54   89    69 0.784   1.86
atatgcactgttactcctacaggtgtctttaacattggtcaactcatgtagacattgcag
agattggtgactttatcaaagtagttcatgctgctaaagtcaatgatagcacatttttga
gaatggcacaatgcaggatccaaatattttggcaacattttttattgtattcctacttag
GGTCCAAATGGTGAACAAGGAAGTGCTGGAATCCCTGGACCATTTGGCCCAAGA
gtaagtaacaaaaagtagtaagttgcaggtgtaaataataatgcctttgttgatgtactg
ctaatgcttgagtatcgttttcctggtattgaagctggagttggctcatcttctctgagg
ttggcaacacacatatgagacaagctatttagcaattaattttaagtagaaatatcttga

 2.39 Intr + 139270 139377  108  0  0  104   88   147 0.992  15.86
tcttatgtgatgaaatcataaatgttacaaagtaccagaagttcatttattaatcagtaa
gaaaatgaatcttagaaatcactgttacagctccatatgtaaaatagttctttgattaga
gaaaggcattgtaaaatttttccttcatagaatctaaactacagtctttgtttcttgcag
GGTCCTCCAGGCCCAGTTGGTCCTTCAGGTAAAGAAGGAAACCCTGGGCCACTTGGGCCA
ATTGGACCTCCAGGTGTACGAGGCAGTGTAGGAGAAGCAGGACCTGAG
gtaaagtcacaaaggtttacatgcaagaaatgctatttattcaatagctcagattccgtc
caagaaatgtctgtgcagcccgattgacaagagacttaagggaccccgaaaacaaacgta
gaagtcacacaagagtataagtaactatttcaagtattttaatacagataagttagagca

 2.40 Intr + 141400 141691  292  0  1   72   89   268 0.987  21.08
atccttgaatgttacagcctgttagaccacccccatctagttacaaaagggcgcgagtca
tagatctccctttactgtcaaattggagtgtctcattggaactccctatgaaccaagttc
taccagttaagtaaaacaaaaacaatgtgttaaatgtctttccaatctctttttaattag
GGCCCTCCTGGTGAGCCTGGCCCACCTGGCCCTCCGGGTCCCCCTGGCCACCTTACAGCT
GCTCTTGGGGATATCATGGGGCACTATGATGAAAGCATGCCAGATCCACTTCCTGAGTTT
ACTGAAGATCAGGCGGCTCCTGATGACAAAAACAAAACGGACCCAGGGGTTCATGCTACC
CTGAAGTCACTCAGTAGTCAGATTGAAACCATGCGCAGCCCCGATGGCTCGAAAAAGCAC
CCAGCCCGCACGTGTGATGACCTAAAGCTTTGCCATTCCGCAAAGCAGAGTG
gtgagtagacagcagcccatttgagcaaaacccgttgtttctgattgtttattctcaact
gcattccaaaatatgttactgactttctacttagtgatagatttgagataaaaatagtaa
acatatcatggagcttataatttaatggtggaaacagtcaattttgtgaaaacatgaaaa

 2.41 Intr + 144160 144347  188  2  2   25   91    93 0.976   1.79
actagaatgtagaaaggcccccaatgcataccggttacttttttcgtaaggggcactctc
acttaaaagaatccttaatcagtgagtgtatattttcaaaccctctgttaattcttttgg
agacttatagtcatgattgagattgtctttatttagtaaaatttctattttgaaaaatag
GTGAATACTGGATTGATCCTAACCAAGGATCTGTTGAAGATGCAATCAAAGTTTACTGCA
ACATGGAAACAGGAGAAACATGTATTTCAGCAAACCCATCCAGTGTACCACGTAAAACCT
GGTGGGCCAGTAAATCTCCTGACAATAAACCTGTTTGGTATGGTCTTGATATGAACAGAG
GGTCTCAG
gtaatttaatatgtttacttaaaattgtattctttactttttactacttattacatattt
ttgatttatttaggactttgctatttttttaaaccaggcttattttaccatgtttatttt
gaagtgatatagtctcattagttacaattgtaataccattgcataaacaaggttttgcta

 2.42 Intr + 145808 146047  240  1  0   81   84   189 0.996  14.62
atagacattttaagatatgtttagatgtacagctagaatagcttactttatgacaagaat
taaagtaatactcttcaaaattgatttatctgaaatcaatttatatatttatctatacat
gtgtaaggcattatgaaacccttcagtcttgtgtatgacaaagactctttgtttttctag
TTCGCTTATGGAGACCACCAATCACCTAATACAGCCATTACTCAGATGACTTTTTTGCGC
CTTTTATCAAAAGAAGCCTCCCAGAACATCACTTACATCTGTAAAAACAGTGTAGGATAC
ATGGACGATCAAGCTAAGAACCTCAAAAAAGCTGTGGTTCTCAAAGGGGCAAATGACTTA
GATATCAAAGCAGAGGGAAATATTAGATTCCGGTATATCGTTCTTCAAGACACTTGCTCT

gtaagtactttttgatctacattgatctggttgaggaaaaaaaattatttttgttaaaaa
tactattacagcactagaactgggggcaattttaccttgtatatgagcataatagcagtt
tgtttatagtcattccttagggtaaatgtgtgtgtgttagcacatgaagcatgatagagg

 2.43 Term + 146747 146893  147  1  0   57   39   155 0.995   4.42
tgaaagaaattctgttacataagtacactaatatttcactttatgttttcattccttttt
tttaagtagtactctaaaaatcattgcctttacattataaaagtgtctgggaaggttgct
gtctaacatacttggaaaaaattgtatgtacatttaacccattgcatcatttaatttcag
AAGCGGAATGGAAATGTGGGCAAGACTGTCTTTGAATATAGAACACAGAATGTGGCACGC
TTGCCCATCATAGATCTTGCTCCTGTGGATGTTGGCGGCACAGACCAGGAATTCGGCGTT
GAAATTGGGCCAGTTTGTTTTGTGTAA
agtaagccaagacacatcgacaatgagcaccaccatcaatgaccaccgccattcacaaga
actttgactgtttgaagttgatcctgagactcttgaagtaatggctgatcctgcatcagc
attgtatatatggtcttaagtgcctggcctccttatccttcagaatatttattttactta

Predicted peptide sequence(s):


>COL5A2_1|GENSCAN_predicted_peptide_1|54_aa
MISSYIDRMNNEGNGKGIPERSGRSLFRLITIQCLPSNGLIDGKQPNQNTRLCA

>COL5A2_1|GENSCAN_predicted_peptide_2|1303_aa
MRNVEFLASPLHGLKKELNAVPLRLSLLMINSALEQKEGKDFLEGYGEEIACTQNGQMYL
NRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGR
GRKGPPGSQGPRGERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPSHPGPDGLSRGP
VGPRGPQGLQGQQGGAGPTGPPGEPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGE
VGFAGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGQ
RGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGS
PGLPGAIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGPHGIQGP
IGPPGEEGKRGPRGDPGTVGPPGPVGERGAQGERGPVGSSGPKGSQGDPGRPGEPGLPGA
RGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGSMGLPGPKGSSGAPGKDGE
VGPSGPVGPPGLAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGERGNPGERGEPGI
TGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGE
KGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPTGA
VGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRGTQGP
PGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAGPPGGPGDKGDPGEDGQPGTPGK
VGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGDRGDPGPAGLPGSQGAPGTPGPVGAPGD
AGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRGQKGHRGFTGLQGLPGP
PGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPGVRGSVGEAGPEGPPGE
PGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDDKNKTDPGVHATLKSLS
SQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSVEDAIKVYCNMETGETC
ISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSPNTAITQMTFLRLLSKE
ASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIRFRYIVLQDTCSKRNGN
VGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCFV