GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:51:37

Sequence CNNM4_1 : 53128 bp : 50.21% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1058   2459 1402  1  1  109   86  2402 0.668 230.98
gcctccaatgcaaatgaggggcgtgggcaggcggggcggggcgggcggggcgctgacctg
acgtcaggctcgcggcccgggcagttggctcggcggcagcggagcggccggagctgcggt
gcggaccggggccgcgcggcgtggcgcggggagcggcggcggcggcagagccagagcaac
ATGGCGCCGGTGGGCGGGGGCGGGCGCCCGGTCGGCGGACCGGCCCGCGGGCGCCTCCTC
CTGGCGGCGCCGGTGCTGCTGGTGCTGCTGTGGGCGCTGGGGGCCCGGGGCCAGGGCAGC
CCCCAGCAGGGCACGATCGTGGGCATGAGGCTGGCGAGCTGCAACAAGTCGTGTGGGACG
AACCCGGATGGCATCATCTTCGTGTCCGAGGGCAGCACCGTGAACCTGAGGCTGTACGGC
TACAGCCTGGGCAACATCTCCAGCAACCTGATCTCCTTCACCGAGGTGGACGATGCCGAG
ACCCTCCACAAGTCCACCAGCTGCCTCGAGCTCACCAAGGACCTGGTCGTCCAGCAGCTG
GTCAACGTGAGCCGCGGGAACACGTCCGGCGTGCTGGTGGTGCTCACCAAGTTCCTCCGG
AGGAGCGAGAGCATGAAGCTGTATGCACTGTGCACCCGGGCCCAGCCCGACGGGCCCTGG
CTGAAGTGGACGGACAAGGACTCACTGCTCTTCATGGTGGAGGAGCCTGGGAGGTTCCTG
CCTCTCTGGCTGCACATTCTCCTAATTACGGTGCTGCTGGTGCTGTCGGGCATATTTTCT
GGCCTCAACCTCGGGCTTATGGCCCTGGACCCCATGGAGCTGCGCATCGTGCAGAACTGT
GGCACCGAGAAGGAGAGGCGCTATGCCCGCAAGATTGAGCCCATCCGGCGCAAGGGCAAC
TACCTTCTCTGCTCGTTGCTCCTAGGGAACGTGCTGGTCAACACCTCCCTCACAATCCTT
CTAGACAACCTCATCGGGTCCGGCCTCATGGCGGTGGCCTCCTCCACCATTGGCATTGTC
ATCTTTGGGGAGATCCTACCTCAGGCCCTGTGCTCCCGACATGGGCTGGCTGTGGGTGCC
AACACCATCCTTCTCACCAAATTCTTTATGCTACTCACCTTCCCCCTCAGTTTTCCCATT
AGCAAGCTCCTGGACTTTTTTCTGGGCCAGGAGATTCGCACTGTTTACAACCGGGAGAAG
CTGATGGAGATGTTGAAGGTGACGGAGCCCTATAATGACCTCGTGAAAGAGGAGCTCAAT
ATGATCCAGGGTGCCCTGGAACTACGGACCAAAACTGTAGAGGATATCATGACCCAGCTC
CAGGACTGCTTCATGATCCGCAGCGATGCCATCCTGGACTTCAACACCATGTCGGAGATA
ATGGAAAGCGGCTATACTCGCATCCCGGTGTTCGAAGACGAGCAGTCCAATATTGTAGAT
ATTCTCTACGTCAAAGACTTGGCCTTTGTGGACCCCGATGACTGCACCCCCCTCAAGACT
ATCACTCGCTTCTATAACCACCCGGTGCACTTTGTCTTCCATGACACCAAGTTGGATGCC
ATGCTGGAGGAGTTCAAGAAGG
gtaaggccagatgtagttcccctggttcaatttcctcttgacgcctcttttcccctggcg
tgttttgtgtctgctggctttagtgttctgtttgtgtgactctgtgtccctttgcctatc
gcttcctatgcttctgaggtgaacgattttggagcggtagacccattctcaagtgtctgc

 1.02 Intr +  37070  37213  144  0  0  108   79   391 0.992  40.45
tccttttcataaaagcaatgtctgtttgcagtagaaacgtcaggaaagatggaaaagata
aaaaccaccatgaccccatcctggtgacttatgaccctacgtctagagttaatgttttgg
ttgagggagtctcatgactggcctctgggctcttgtctgacttgctgcattgtcccacag
GGAAGTCCCACCTGGCCATCGTGCAGAAGGTAAACAACGAGGGTGAGGGTGACCCCTTCT
ACGAGGTCCTGGGCCTGGTCACCCTGGAGGACGTGATCGAGGAGATCATCAAGTCGGAGA
TCCTGGACGAGTCCGACATGTACA
gtgagtccagccttccacagggcccaggacccctttcctgcttggatcgaaacttggtgt
ccctagctggaagggccatagtgcagggacacaggaggcctagcatccagaggcccagtg
gctgggtgccctgcactggccggggtgagcagggagcaggttgctgagagcagtgcccgg

 1.03 Intr +  37571  37705  135  0  0  103   69   197 0.511  19.84
cggaggctgccttcaccctcggcctttgtgcctcggcgtcagcccaggaccctgccagcc
agagcctgctgctcctgcgtgggactaggggctggagagcaggagctgcggggcgggttc
cagtctcttcctaagtcctcaggggtctgtgttctcaattccacgctcttcttccggcag
CTGACAACCGAAGCCGGAAGCGGGTGTCTGAGAAGAACAAGCGTGACTTCTCTGCCTTCA
AGGATGCGGACAATGAGCTCAAAGTGAAAATCTCCCCGCAGCTCCTCCTGGCCGCTCATC
GCTTCCTAGCCACAG
gtagcatgaggaggaccttccggtcttggtggaaatacggtcacgggggagaagtcctgg
gtttccggctgctttccccccataggacgagggctgcagcaggtgaggggtgcagagaca
acacagccacccctggaaggggccgggtatctgctccacccctggggatctccctgcgat

 1.04 Intr +  39115  39284  170  2  2  107   99   315 0.995  34.17
ccagtcagaagccaagcgtgctccctccccagggaggtgcagaacgagggccggccgagc
agggcgggagtcgtctgagcacagcgtggctgctgtggttggggtggaggcacagcagtg
atcgagctttagggccacctggccagccccgtgtgaggtctcttctctctcctcctacag
AGGTCTCTCAGTTTAGCCCCTCCCTGATATCAGAGAAGATCCTGCTGCGGCTACTCAAGT
ACCCAGATGTCATTCAGGAACTCAAGTTTGACGAGCACAATAAGTACTACGCCCGCCATT
ACCTGTACACCCGAAATAAGCCGGCCGACTACTTCATCCTCATCCTGCAG
gtgagcccgctcagccctgggcctgccacctgctccccctggcactgcagcaacccccag
gccctctctcccacctgctgcggaggtgcatggcttccctgcctggggagcctgctgcct
gcccttgagccccgcctgccccacgtggccatcctctccctgagaggccactcttgatct

 1.05 Intr +  39610  39706   97  0  1  102  117    65 0.993  10.38
tggccatcctctccctgagaggccactcttgatctcacaggtcaggcccctgagctctcc
agggctccagtaccggcccttcctcctgccccactgtcccttgttcctcactccccatcc
tgcctcatcctttgtttcctccctcacttggtctctaactccagccctgtgttttttcag
GGGAAGGTGGAGGTGGAGGCAGGGAAGGAGAACATGAAGTTTGAGACGGGCGCCTTCTCC
TACTATGGGACTATGGCCCTGACCTCGGTCCCCTCCG
gtgagttgttgggcatggtctttgctgccctttggcccccctgcagctggggagccatgg
accgacaccagaactgagcatgggcccgagagctcatagccagctggctggggcagaggg
aggctggtgaggcgggagccgccagggcctggagcgggtggtgtggaagagcagagggag

 1.06 Intr +  41130  41192   63  1  0  101   97    -5 0.474   0.39
cgcacagggctcaccgctgtgccctgagcacccttcccagcagagccatgtccctttctc
cactgggcccatctctgcccaaagcagcctggccccgtcaggtctgcctctgtcctgtgc
ctgtggttccgtgtcctgtctcctgactgcgcccatcactgaccttctcttttgctccag
TGCCTTCAGTCCAGGTCGGGTGTCCGCCTGGCAAGCGGAACTCCCTGCTCTGCTGGCTCA
CAG
gtaacgtggcacagctgagggtcacgctgccacctgctgcctgtgcctgcacactgcagc
tgcattaacctccccacatggacccggacccccgcctgctcaatgtgggccgccagacct
cagtggctctgcttggctggggcccaatttctaggcagctttgctgcctcagctctagaa

 1.07 Intr +  48619  48800  182  2  2  110  113   178 0.715  22.09
tgctttaacgaagtcagaccttatgcagtcagaccttctacatgcttctgtttgtcccta
agaatgacttcctgttcctgggtggggtgtccctgggcttccatgggatgaggtgagaca
tgagggtgagagtgggcatcggagtggcctttggcatgacaacctctgctctccctgcag
ACCGTTCCCCAGCACACCCCACCCCACTCAGCCGCTCAGCCTCCCTCAGTTACCCAGACC
GCACAGACGTCTCAACTGCAGCAACCTTGGCAGGCAGCAGCAACCAGTTTGGCAGCTCTG
TCCTGGGCCAGTACATCTCTGACTTCAGCGTCCGGGCACTCGTGGACTTGCAGTACATCA
AG
gtgagtgcctcactgccctgtctgggcagtgctatcttctgctcaggaatcagctactac
tttcatccaccaaacccagcatggtgggcccaaacccgagatgcctttttcttctggaga
tggggtcttgctctgtcgcccaggctggaatgcagtggtgtgatcatagcccacttcagc

 1.08 Term +  49378  49575  198  0  0  106   48   329 0.999  28.10
ccctgagatgctttcttctcttgttcgtgcaccttgttctttgtaagggcttccagagac
gctgactggtcatgttctctctcaactcacagcctcaatcctggccctgtttctccaggc
ctggtgatagggtctgcctcccagcccctccctccatgaactcatcccttcctcatgcag
ATCACTCGGCAGCAGTACCAGAACGGGCTGCTGGCTTCTCGCATGGAGAACAGCCCTCAG
TTTCCCATAGACGGGTGCACCACCCACATGGAGAACTTGGCCGAGAAGTCTGAGCTGCCT
GTGGTGGACGAGACCACAACTCTTCTCAACGAGCGTAACTCCTTGCTGCACAAAGCCTCC
CACGAGAATGCCATCTGA
caggagggcccggggccccctgcccaccctgcgggggcctccccagtgggcccacatgaa
gagagggaacctgttagtccagaaaggatacggatagatagcctgtctgactgaacagcc
agatggcccccagcctatgggggatctggcctctgccagggacctctgagtagctctgag

Predicted peptide sequence(s):


>CNNM4_1|GENSCAN_predicted_peptide_1|796_aa
MAPVGGGGRPVGGPARGRLLLAAPVLLVLLWALGARGQGSPQQGTIVGMRLASCNKSCGT
NPDGIIFVSEGSTVNLRLYGYSLGNISSNLISFTEVDDAETLHKSTSCLELTKDLVVQQL
VNVSRGNTSGVLVVLTKFLRRSESMKLYALCTRAQPDGPWLKWTDKDSLLFMVEEPGRFL
PLWLHILLITVLLVLSGIFSGLNLGLMALDPMELRIVQNCGTEKERRYARKIEPIRRKGN
YLLCSLLLGNVLVNTSLTILLDNLIGSGLMAVASSTIGIVIFGEILPQALCSRHGLAVGA
NTILLTKFFMLLTFPLSFPISKLLDFFLGQEIRTVYNREKLMEMLKVTEPYNDLVKEELN
MIQGALELRTKTVEDIMTQLQDCFMIRSDAILDFNTMSEIMESGYTRIPVFEDEQSNIVD
ILYVKDLAFVDPDDCTPLKTITRFYNHPVHFVFHDTKLDAMLEEFKKGKSHLAIVQKVNN
EGEGDPFYEVLGLVTLEDVIEEIIKSEILDESDMYTDNRSRKRVSEKNKRDFSAFKDADN
ELKVKISPQLLLAAHRFLATEVSQFSPSLISEKILLRLLKYPDVIQELKFDEHNKYYARH
YLYTRNKPADYFILILQGKVEVEAGKENMKFETGAFSYYGTMALTSVPSVPSVQVGCPPG
KRNSLLCWLTDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFS
VRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLL
NERNSLLHKASHENAI