GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:52:04

Sequence CNNM3_1 : 18818 bp : 53.54% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    324   1548 1225  2  1   83   82  2207 0.047 210.80
ccccggcccgcccctggccgccacttgtttactccccggcgcagcctagtccgaccctgg
ggcccgcccccgcccaccgcctattggccgaggaggcgcgaagagccgtaacgattggcc
cggggaggcgcggggcgagcggggtaggctgcgcgagaggccgagagggggcagcaggcg
ATGGCGGCGGCGGTAGCTGCGGCGGGTCGGTTAGGCTGGTTGTTCGCCGCGCTCTGCCTG
GGCAACGCCGCGGGGGAGGCCGCGCCGGGCCCGCGAGTGCTGGGCTTCTGCCTGGAGGAG
GATGGAGCGGCGGGCGCGGGTTGGGTACGCGGAGGGGCGGCGCGGGACACGCCGGACGCC
ACCTTCCTCCTGCGCCTCTTCGGCCCGGGCTTCGCCAACAGCTCTTGGTCCTGGGTGGCC
CCGGAGGGGGCGGGCTGCCGGGAGGAGGCGGCCTCCCCCGCGGGCGAGTGGCGCGCGCTG
CTGCGCTTGCGCCTGCGGGCCGAGGCCGTGCGCCCGCACTCGGCGCTGCTGGCGGTGCGC
GTGGAGCCGGGTGGCGGGGCGGCTGAGGAGGCGGCGCCGCCCTGGGCTCTGGGCCTGGGG
GCGGCCGGGCTGCTGGCGCTGGCAGCGCTGGCGCGAGGCCTGCAGCTGAGCGCGCTGGCG
CTGGCGCCTGCCGAGGTGCAGGTGCTGCGCGAGAGCGGCTCGGAGGCGGAGCGTGCGGCG
GCGCGGCGTTTGGAGCCCGCGCGGCGCTGGGCCGGCTGCGCCTTGGGCGCGCTGCTGCTG
CTGGCCAGCCTGGCGCAGGCGGCGCTGGCGGTGCTGCTGTACCGCGCGGCCGGCCAGCGT
GCGGTGCCCGCCGTGTTGGGCAGCGCGGGGCTCGTGTTCCTGGTGGGAGAGGTGGTGCCG
GCCGCCGTGAGCGGGCGCTGGACGCTGGCGCTGGCGCCGCGAGCGCTCGGCCTCAGCCGC
CTGGCCGTCCTGCTCACTCTGCCCGTCGCGCTGCCCGTGGGGCAGCTGCTGGAGCTGGCG
GCGCGGCCCGGGCGGCTGCGGGAGCGGGTGCTGGAGCTGGCGCGCGGCGGCGGCGACCCC
TACAGCGATCTCAGCAAGGGCGTGCTGCGCTGCCGGACCGTGGAGGACGTGCTCACGCCC
CTCGAAGACTGCTTCATGCTGGACGCCAGCACCGTGCTGGACTTCGGCGTCCTGGCCAGC
ATCATGCAGAGCGGCCACACGCGCATCCCGGTGTACGAGGAGGAGCGCTCCAACATCGTG
GACATGCTCTACCTCAAGGACTTGGCCTTCGTGGATCCCGAAGACTGCACGCCGCTCAGC
ACCATCACTCGTTTCTACAACCATCCGCTCCACTTCGTCTTCAACGACACCAAGCTGGAC
GCTGTCCTGGAGGAATTCAAGCGAG
gtaacggcccgggcatggtgcaggggacgcccgtgcgagtgccctctccctgaaaagggg
tggagagttatggaagccttctggaaagggtcccacccctgtggagagcagtgagacctc
taaggtcccttttcaagacggtattggccttgcagcttggaatgaccttttgaaatactt

 1.02 Intr +   9104   9247  144  0  0  104   84   385 0.999  40.46
agttctcataatcacgctgggagtcttaagtaaaaacctagaaaagagtgtggctctgtg
cctggcacgttgtaggagcatgaacgttagccgtgtccttttggtgggcctataccaggg
gagatgaatcaaactggggggggcccagcaagctgttccatgagtgtcctccccccacag
GGAAGTCCCACCTGGCCATCGTGCAGAAGGTGAACAACGAGGGTGAAGGCGACCCCTTCT
ACGAGGTCCTGGGCCTGGTCACCCTGGAGGACGTGATCGAGGAGATCATCAGGTCCGAGA
TCCTGGACGAGTCTGAAGACTACC
gtgagtccagactcttggcagttctgtctccgctgggcctgcacacttccccaggcgtat
gttgcgtcagaggccagtgggcctctgtgctgctggaacccagcaagatccacagccagg
cccccttctgagccctgcatgggtgctggcagagagcccccttgcaggagggctcacgcc

 1.03 Intr +  10879  11028  150  2  0   88   78   163 0.997  15.95
ggggtgggagcaggccccgtggagggagcggtgctgaggacatgtccctggcgttccgat
gctgctccatcgaggaccccctggcctcaggaggaaggagcaggcgatgcagccccttag
tgtggtcgtgttgactgacaggtggctgatgcctgagcgcgccctcttcttccatcttag
GAGACACCGTGGTGAAGAGGAAGCCTGCTTCTCTGATGGCCCCTCTGAAGCGGAAGGAGG
AGTTCTCCTTGTTCAAGGTGTCTGATGATGAATATAAAGTAACAATCTCGCCTCAGCTGC
TCTTGGCCACCCAGCGCTTCCTGTCCCGAG
gtgaggcgggagggtggtccatgccccctgctctcctcaccgttctgtgggtcaggaggc
cgcccagggccgacactgactctgctccccactcctagcaggcgggtgcgtcttgaggac
ttctgtgttctctgcagccctgccagcatcttgggtcatgggagagacacctcctctctg

 1.04 Intr +  11777  11946  170  0  2   67   70   296 0.962  25.88
agccaccgcacctggcccctgcctagttctcttgtgttgaggtgttaggggcagctgctc
acaggccacccgggagatccctggtgggcacaataactttaaattgcctacagtgttggg
tgtggttccactggccactaggccccagtggacactgtcccttttttccaccacgtgcag
AAGTGGATGTATTCAGCCCGCTGCGCATCTCTGAGAAGGTCCTGCTGCACCTGTTGAAGC
ATCCCAGTGTCAACCAGGAAGTGAGGTTTGACGAGAGCAACCGGCTGGCCACACACCACT
ACCTGTACCAGCGCAGCCAGCCGGTGGATTACTTCATTCTCATCCTGCAG
gtagctgtgggtcccaggcctggagtccctcctgcttcctcaggccagggaagggtctag
gagaagaggggagcaggggcatgcggatatgcaccctcccaccccaaacaattgaggtgg
tgggtttctccttccgctgtcttctgacgggaaaggtaatctggccgcatctgtttctct

 1.05 Intr +  12145  12241   97  0  1   83  102   116 0.999  12.58
cctggagtccctcctgcttcctcaggccagggaagggtctaggagaagaggggagcaggg
gcatgcggatatgcaccctcccaccccaaacaattgaggtggtgggtttctccttccgct
gtcttctgacgggaaaggtaatctggccgcatctgtttctctccttgccactcctcccag
GGCAGGGTTGAAGTGGAGATCGGGAAAGAGGGTCTGAAGTTTGAGAATGGGGCCTTCACG
TACTATGGAGTGTCGGCCCTAACTGTGCCATCCTCGG
gtaagccacggccctgctgatgctgagggccagggtggaggctgcagagcctgtccccca
tcatcacttgggctctcagtgcccctcctcacctctccttccacctgagcccaccacccc
acaaggtggtgtagcccctgggcttccaggagggagggcagcattcttcatcgctcaact

 1.06 Intr +  12613  12746  134  2  2   62   57   216 0.833  16.77
tccacccctgcaaaacctctcccggctgtgtttgtccttctctcccagcttcccatgcac
attgcctctccagagtgattggtggggtgggtcttcgaaactgtacagttgtccccacca
ggggaggaggctcccagctgccagcatggctcctgccatcactgattgttcctttgatag
TTCACCAGTCCCCGGTGTCCTCGCTCCAGCCCATCCGCCATGACCTGCAGCCCGACCCAG
GTGACGGCACGCATTCATCTGCGTATTGTCCCGACTACACCGTGAGGGCGCTCTCTGATC
TGCAGCTCATCAAG
gtgactgcctgggctgcttgtgggtgctggctttagccgactttgtgtcaccgggggcta
gaccagctggtctgagactgcccggaacaaggccttccactcatcctgagggacacagac
ctttgcacccagtttccaagcaaggtcttaaaaacacttgactcagttgctcttctctgc

 1.07 Intr +  12937  13180  244  0  1   78  109   187 0.494  17.40
gggctgcttgtgggtgctggctttagccgactttgtgtcaccgggggctagaccagctgg
tctgagactgcccggaacaaggccttccactcatcctgagggacacagacctttgcaccc
agtttccaagcaaggtcttaaaaacacttgactcagttgctcttctctgcccttaactag
CTTAAAGTTGTGCCTCTGTCCTCTTCGGGCACGGTGTCACCTTTCCTGCCTACCTTCTGC
ATCTCGCTTCACCAATTGGGTCCCAGTAACGCTGTCATCCTCCAGGTTACGCGACTGCAG
TACCTCAATGCACTCCTGGCTACCCGAGCCCAGAACCTGCCACAGTCCCCTGAGAACACC
GACCTGCAGGTTATTCCAGGCAGCCAGACCAGGCTCCTTGGTGAGAAGACCACCACAGCG
GCAG
gtgagtgccaagtggtacatcgtgcatggtgtctggacctgagggccgtgagctcacaca
cacagacttgcactctcgccgcccccccaccctctgtcttttttctctcttttctcccca
tccttttcccttctttatatatatatatctatatataaataattttttttttttttgaga

 1.08 Term +  16598  16662   65  0  2  119   43     5 0.192  -2.56
gcatctgttggctgaccatctgctaaccagtcgctcctgtttctgctctgatacttccca
aggcatcccgaagcacctgtcttagctgccccttcctgtcccacagaggatttggcactt
ggttttgacaggatactttaccagctttgatgttaattctccttcccttgtctcctgtag
GGTCCAGCCACAGCAGGCCCGGCGTCCCGGTGGAAGGCAGCCCTGGGCGGAACCCAGGCG
TTTAA
cggctcactaggcagccccagatctggggaacagatgagcacgtggggagctggagtgag
ctgagcagaagttttgtgcccgcctgcccccatcccctccaggccacgttttagatggcc
cttgtagttgcgggtcctgggtgtcctcagaactagacatcaatgcctggatccttcagc

Predicted peptide sequence(s):


>CNNM3_1|GENSCAN_predicted_peptide_1|742_aa
MAAAVAAAGRLGWLFAALCLGNAAGEAAPGPRVLGFCLEEDGAAGAGWVRGGAARDTPDA
TFLLRLFGPGFANSSWSWVAPEGAGCREEAASPAGEWRALLRLRLRAEAVRPHSALLAVR
VEPGGGAAEEAAPPWALGLGAAGLLALAALARGLQLSALALAPAEVQVLRESGSEAERAA
ARRLEPARRWAGCALGALLLLASLAQAALAVLLYRAAGQRAVPAVLGSAGLVFLVGEVVP
AAVSGRWTLALAPRALGLSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELARGGGDP
YSDLSKGVLRCRTVEDVLTPLEDCFMLDASTVLDFGVLASIMQSGHTRIPVYEEERSNIV
DMLYLKDLAFVDPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLAIVQKVN
NEGEGDPFYEVLGLVTLEDVIEEIIRSEILDESEDYRDTVVKRKPASLMAPLKRKEEFSL
FKVSDDEYKVTISPQLLLATQRFLSREVDVFSPLRISEKVLLHLLKHPSVNQEVRFDESN
RLATHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTVPSSVHQSP
VSSLQPIRHDLQPDPGDGTHSSAYCPDYTVRALSDLQLIKLKVVPLSSSGTVSPFLPTFC
ISLHQLGPSNAVILQVTRLQYLNALLATRAQNLPQSPENTDLQVIPGSQTRLLGEKTTTA
AGSSHSRPGVPVEGSPGRNPGV