GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:43:47

Sequence CCL20_1 : 6080 bp : 37.52% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1259   1334   76  1  1   61  115   117 0.999  11.01
tgatgacatgatggggccagttgatcaatggggaaaaccccatgtggcaacacgccttct
gtgtacattcccaatatttgctataaatagggccatcccaggctgctgtcagaatataac
agcactcccaaagaactgggtactcaacactgagcagatctgttctttgagctaaaaacc
ATGTGCTGTACCAAGAGTTTGCTCCTGGCTGCTTTGATGTCAGTGCTGCTACTCCACCTC
TGCGGCGAATCAGAAG
gtaagtgtcgctctttccgctagcacagaagaaagactattttcattttccttttagcct
tgagctcaactgggggtccctaagggatggaaaactgttaggaagtatacaagaggtagt
gatggaagttgtctgcccatggtggagtggaggagagaagagttactgctgcggatcagg

 1.02 Intr +   2801   2915  115  0  1   82  103   135 0.516  12.99
ttggttctcaacgaccttacaaaggtttccaagacattgaaactcctcctctaagtggtt
tattcgtcatatacatgagattcactagatttttcacaacttaaggtagttttataatac
caatcacaggataagtttattcatgtggatccaatacctttcacttttttttttttttag
CAGCAAGCAACTTTGACTGCTGTCTTGGATACACAGACCGTATTCTTCATCCTAAATTTA
TTGTGGGCTTCACACGGCAGCTGGCCAATGAAGGCTGTGACATCAATGCTATCAT
gtaagttattaattgattttaattcagttgtatcaggaatacctagaaacttcagtttta
aaaatgtttgcctttttagagtttcattcagaaattactgatgttttgaacataagatct
tattttaaagagaaagaaatgatgtggcaaagatagctttgtcttagtacatatctactt

Predicted peptide sequence(s):


>CCL20_1|GENSCAN_predicted_peptide_1|64_aa
MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI
NAIX