GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:42:08

Sequence CAPN14_1 : 47287 bp : 44.65% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +  13161  13313  153  2  0   76   73    93 0.368   6.58
tcccttctgtaggcttttgccacaagatccctgatctcccaccaggtcctcaagcacttg
agtgagtgctcaaggacccacactctctgggacaaaatcgaaccacctgcttctgtctct
ttctcaccagctgacttctccgctcccattctctccatccttcccctcgtctctgtggca
ATGGCAAAGCACAAGGAGGAAGTGAGGAAACTGACCGTCCTCTCTCCATTTCAGGAGCAG
CAGAGACTCCTCAGGAAGACTCACTGGACTGTACCCACCACCTGCCATGTCTCTGTGGCC
ACCTTTCCGATGCAGATGGAAGCTGGCGCCAAG
gtactctaggagggcgtctccacagcaaccccaacaggactttgaggccctgctggcaga
gtgcctgaggaatggctgcctctttgaagacaccagcttcccggccaccctgagctccat
cggcagtggctccctgctgcagaagctgccaccccgcctgcagtggaagaggcccccggt

 1.02 Intr +  13351  13491  141  0  0  -13   93   187 0.438   9.65
acaaggaggaagtgaggaaactgaccgtcctctctccatttcaggagcagcagagactcc
tcaggaagactcactggactgtacccaccacctgccatgtctctgtggccacctttccga
tgcagatggaagctggcgccaaggtactctaggagggcgtctccacagcaaccccaacag
GACTTTGAGGCCCTGCTGGCAGAGTGCCTGAGGAATGGCTGCCTCTTTGAAGACACCAGC
TTCCCGGCCACCCTGAGCTCCATCGGCAGTGGCTCCCTGCTGCAGAAGCTGCCACCCCGC
CTGCAGTGGAAGAGGCCCCCG
gtgaggcaaaatgtgtcagcccagaccctccttccccagggtttagggctttcagatact
gcgcctaagatatatgggagaaaaaaacaggctttttcctactctctcctctccactcaa
cacaacacactcttctaacaccagatgtgtaggaggttttccccacatgccaagcaattc

 1.03 Intr +  15575  15644   70  1  1   88   97     7 0.974   0.35
tgagaaatacaaaggacagaattctgtatcccagatcttctgggatagcactgattacac
ctatattctgtatctttgtccccataagtacagttttggggtatgggaaaacgtggtcac
tgtagctccaggagcttttttgttctaggtcagaatgacaattctgtttgtctttcccag
GAGCTGCACAGCAATCCCCAGTTTTATTTTGCCAAGGCCAAAAGGCTGGATCTGTGCCAG
GGGATAGTAG
gtaagtttgcacagccccgagagacagacactaggctgcctgctgaccaggcctggccaa
gacagagtggttgataaagaagagaagccagagatccccactggagagaggcccaaaatg
gctattcactggcaaaacgctacctggacatgttctgttctttgccgtgaagtttataaa

 1.04 Intr +  16462  16580  119  2  2   23   92   141 0.819   8.18
atttcagccaatgctcccagccccacctctgctcactcatcatccgccttcccagtatat
aattcccttctcctaaactgggctacaagcccagagagggtggccattgggaccgggcat
tttctgcagtcataaagtccccagtagattcatgcagatgctgtgtgctgtctgacttag
GAGACTGCTGGTTCTTGGCTGCTTTGCAAGCTCTGGCCTTGCACCAGGACATCCTGAGCC
GGGTTGTTCCCCTGAATCAGAGTTTCACTGAGAAGTATGCTGGCATCTTCCGGTTCTGG
gtgagtgtcttcccgggtcctcagcccagagggagtcataggaaaaagggttcctggagg
accatgtcttcaccttctgggctgatcaccatctgcagcagtcctcattcacccggggcc
actctctccctccagttctggcactatgggaactgggttcctgtggtgatcgatgaccgt

 1.05 Intr +  16716  16852  137  2  2   89   71   152 0.947  12.97
aatcagagtttcactgagaagtatgctggcatcttccggttctgggtgagtgtcttcccg
ggtcctcagcccagagggagtcataggaaaaagggttcctggaggaccatgtcttcacct
tctgggctgatcaccatctgcagcagtcctcattcacccggggccactctctccctccag
TTCTGGCACTATGGGAACTGGGTTCCTGTGGTGATCGATGACCGTCTGCCTGTGAATGAG
GCTGGCCAGCTGGTCTTTGTCTCCTCCACCTATAAGAACTTGTTCTGGGGAGCACTTCTG
GAAAAGGCCTATGCCAA
gtaagaaaccggcagaaatatcccccttcccatcgcttctttttctctctctcaatgttg
agggaggggagtggagtcaggtaaagtttatgaaatgagatcctgaggcatgtcttagcc
aacatagaagtgacaacgtattcagtcttttatgtaggggtcacctcatctaaacctgca

 1.06 Intr +  18089  18263  175  2  1   86   64   267 0.999  24.04
gaccaccagctggagccattcaggatgggtatggtattggaaactatgtcagggttgcct
gagctctgcttttggtatgagaaaactagactcctatttaaaagtggatgccgaggccac
ataaaattataaatactcatgatacttttttcctctcatgtttatttcttccctggccag
GCTCTCTGGTTCCTATGAAGACTTGCAGTCAGGACAGGTGTCTGAAGCCCTTGTAGACTT
CACTGGAGGGGTGACAATGACCATCAACCTGGCAGAAGCCCATGGCAACCTCTGGGACAT
CCTCATCGAAGCCACCTACAACAGAACCCTCATTGGCTGCCAGACCCACTCAGGG
gtgagactgggctgccactggcagaatgtcctcttctcctgcacccatgccctccatcca
ccaccactaccctcacctgggtgtgggctcagggcctccacccagctcctagtgctgagg
tcctggtgttcaaaccagagcagcaaggccaggtgcggtggctcacacctgtaatcccag

 1.07 Intr +  19182  19244   63  2  0  104   98    53 0.991   6.81
tgagagggtggaatgagactatggataccaaagagctttgaaaactgcaatgtaccatac
catgattatctcccacacttctctccataaacccctgctccagccaaacagccttcccac
gactcaaagaataagctgtacataacagaagactgatcaggacctctcttgtctctgcag
GAGAAGATTCTGGAGAATGGGCTGGTGGAAGGCCATGCCTATACTCTCACAGGAATCAGG
AAG
gtgggttgaggttggcccttcggtttccctctcagccttgcccttccctctctggaccct
agcttatcttggtggatttagtttctgtaccatctggagagtgggtaaagtctttggtgg
gtccctgtgcctcggcatctatttcctgcggtgaagtggtgggtccaggctttgccacca

 1.08 Intr +  21380  21465   86  1  2  105   66    41 0.996   2.22
atttgccctaggtctcacagcttgtaagtacaagaagcagagccactttctcctctacca
gctctctctggggctgtgattttccactgcaagtgctcagctccaggcccgagtctcact
cagatctctggaatgtttgcactcagcccagtcacctaaactgcctctcattttatgcag
GTGACCTGCAAACATAGACCTGAATATCTCGTCAAGCTACGGAACCCCTGGGGAAAGGTG
GAATGGAAAGGAGACTGGAGTGACAG
gtgaactttggggacatcttggaggggtgagaacaggtaggttaggcaaaggaggctgcc
atttgcacacagattcaaatgtgtgctttctttggtcttaggctggatcaggaagccttt
agacggggaagctcaatccctcacatttagaagatgctttatggtatagagactgctttc

 1.09 Intr +  24231  24305   75  0  0   92   32    75 0.653   0.93
ccagtgcttggctcatagtaagctatcaattcatgttcatgctactgtataatatggaat
gggaaatttagttgtctgaggtagtatgaaaataataataaataatgacactatagagcc
tttactaaagaatttctagcatgctccccacaagcttttcattcccttttctattttcag
TTCAAGTAAATGGGAGCTGCTGAGCCCCAAGGAGAAGATTCTGCTTCTGAGGAAAGACAA
TGACGGAGAATTCTG
gtattggacttagggacttggacaaatgtcctggcctacatttgaaaacccatccagcag
acatttattggatgccttatgggtgccaggaacttcatgtacagagatcaataaggcacc
atccctttaggagctcacggtctagcaggacaaacagtgcctgtaaataaacggtcactg

 1.10 Intr +  25420  25583  164  1  2  137   84   138 0.997  17.92
cagggatctagccagccccagctgatgtgcctatcgtcagctcagctctgcacaagagct
ggtgtctttgtccatgagagggctgggatgcccactgctccgtttcaccctccccatggg
tcctgataactaggcgttatctggtccatctctttgtgcttttccttcttctctccacag
GATGACGCTGCAGGACTTTAAAACACATTTCGTGCTCCTGGTTATCTGTAAACTGACCCC
AGGCCTGTTGAGCCAGGAGGCGGCCCAGAAGTGGACGTACACCATGCGGGAGGGGAGATG
GGAGAAGCGGAGCACAGCTGGTGGCCAGAGGCAGTTGCTGCAGG
gtgagcatgtgcacaggagcagggctctcagggtgaggttgtgggcgggggtgtcagaat
gactgcacagggggttgcagcacgaattctgcattggctgagtggggaggaggctctgct
tgcctcactgtgtgttggggccctgggctataaccacagggaagatggggtacctttgga

 1.11 Intr +  26616  26779  164  1  2   97   73   164 0.995  15.49
tggaagagcaaggtgggagggcgtaaatccaaggttgaagggaccccgactctgtcccag
tgggcctcagggtgtcaatcctggcagaggcgtcctcagactgttcacctcttagtggtt
cggcaagcaggatgcatggggatccggggcccattctcaccttgctgtgttctgctccag
ACACATTTTGGAAGAACCCGCAGTTCCTGCTGTCTGTCTGGAGGCCCGAGGAGGGCAGGA
GATCCCTGAGGCCCTGCAGCGTGCTGGTGTCCCTGCTCCAGAAGCCCAGGCACAGGTGCC
GCAAGCGGAAGCCTCTCCTCGCCATTGGCTTCTACCTGTATAGG
gtaggtggacctctgaaccacaggggcatgggaccaagcgtgggggtcaccaacagttac
catgtcttcctgtttcctgtcttcttcaccatctgtctctgttcacagacctgggttttc
aaatccaggctctgtcctttaggaacatgtgatttagaacaagtcaccttcttgcactag

 1.12 Intr +  29236  29441  206  0  2   87   55   182 0.996  12.80
ctccacacacatattctggtttttcctttcctccccacttgtttcatcctccactggggc
ctattggatttggcagagcagaggccaccttagtcctggctcagagctttgagggcctca
ggcctggccacagccctgggtcatcacctcccttgctgttcttctgtcctctacccacag
TACCATGATGACCAGAGGAGACTGCCCCCTGAGTTCTTCCAGAGAAACACTCCTCTGAGC
CAGCCTGATAGGTTTCTCAAGGAGAAAGAAGTGAGTCAGGAGCTGTGTCTGGAACCAGGG
ACGTACCTCATCGTGCCCTGCATATTGGAGGCCCACCAGAAGTCAGAGTTCGTCCTCAGG
GTCTTCTCCAGGAAGCACATCTTTTA
gtaaggacacaaggtctctcctagagggtggggaccacttggacgaggacaggcaaggag
ggcaaggttggaaatggcagaaaccaggatctctgctgctgagacaaaagggagatgggg
agagcaggagaccaggtgactttctgcatggagaacatccctcccgttccttcccaccct

 1.13 Intr +  30360  30396   37  0  1   84  113    63 0.996   6.66
gtgcacatggctggaatgtacagttcaaggggaagcaggaggtgaggtgtgagagctggg
tgggcccttgtggtgcctcagtgaaggaacgtggaagacgagctcccaggagaaggggaa
gattggccaaaaaattcccaagaggaaactctgagtttgttcttgtttgtttgttctcag
TGAAATTGGCAGCAATTCTGGTGTCGTCTTCTCAAAG
gtgagtagtctggtggaattccatatggctgggactgctttccaagccagggtgttgggt
ttctcccttcaagttaaggagtcaggggaggagatatgcggatccttacagaccctgttc
tatggcaaacattacccgttgtatcctaacagtacctgggctttgctgtttttgcaccaa

 1.14 Intr +  30900  30956   57  2  0   95   96    49 0.576   5.48
gagtcaggaaaaattggagaagcaagggctgtttgtaaatgctatggtgtaaaattaaag
acgatgcaaagtcaagctcatggatttcagaaacctggaagccatgagacattagggtgt
gcacgaaagtccgtttatacaggtgaataattgtgtctttctgtgtgtctcttcctatag
GAGATAGAAGACCAAAATGAAAGGCAGGATGAATTCTTCACCAAATTCTTTGAAAAG
gttagttgaacaggtgtggtggggggtgaggaagagcaggggacgaagtggagcttctca
ttttataaagtataggtttgcacctgcttgaggctgcttagaaactgtgatttaaggcta
cctattgcccaaactgccactttctattaaagtcctcaagtttttagacaaatgagtgga

 1.15 Intr +  32229  32286   58  2  1   59  108    48 0.402   2.36
atcactgttcttgaaagtcatgccctgccagggttctctggggttggcacccagttaaaa
agcattgtgaagttcttaggaaatcccagtttaatttcatggccagtcatatgacccctc
tgccatctaatgagccttcagtaacagttattttttcttgccaatctgctttctatttag
CATCCAGAGATTAATGCAGTTCAACTTCAGAACCTCCTGAACCAGATGACCTGGTCAA
gtaagtgttttagagccattctgtaggactcagaggggatgcaacttttctaaactctgg
ctttgtttctctttcccttggtgggatgtgtgaattactgagcactggtctcaactctgg
ctatattttacacaaggtggattatgtgatctgaaaaagcagtagggaaatttatacaac

 1.16 Term +  34116  34129   14  1  2  109   53    -9 0.235  -3.94
ctagaaaccaagaggtttagtaagtgttccatgaaataaaaggggttagcttctgtggtt
gattgtacttgggtctttagtacctcacatatggtaaagtgcatggcaaatgaagaaaag
catcaatagacgcaaagtatcccacatttctttgaccacaaaactcctctttctctgcag
AAAATCTCCTTTGA
gacataatttgggaaatgttgactgaaaactggaaatgataggtctactgtattctgttc
aatcaaattgcatctggaggactgtgttcaaatcttggcaccatatttcaaagagatact
ggcaaaatgtagggctcagaaaagggtgttgagggtttagaaaccatcgcatgtgaggag

 2.02 PlyA -  35046  35041    6                              -1.95
 2.01 Sngl -  36150  35095 1056  0  0   60   35   385 0.530  27.56
 2.00 Prom -  36210  36171   40                              -8.96

 3.01 Init +  40153  40203   51  0  0   55  110    78 0.892   7.86
tggactggccagtgaggtgaggcgaactagcgaaatcagacatgatcagacattgaatga
ggccatccacaaattgcacatcactttgtggagggctgatcactgcctccaaagcatgga
tagaactctccctggaagcttttaccttaacctattaatcagcttaatgcatcaggtact
ATGAGCATCCAGGAATTCAGGGACCTGTGGAAGCAGCTGAAGCTCTCTCAG
gtaagaacaagtcttaaccacacctctttggaagatggtgtaggaatggcagttctgcaa
agctgtagaagatacttctgtccccttcagccctttatatccacctcaccaaaccttctc
tattctcccttcggtgagcatttcctctattggtctcttccaaactcagagagctggttg

 3.02 Intr +  40893  40968   76  2  1  108   96    68 0.993   8.69
atgaggcggtaggatcccagcatggactctgccatattcttatcctggcaacaggccctg
catgtggagcctcagatatcttcaacagcccctctgcggtgctgacaaggggcacacagg
gctctcagatggtgcttggaaatgcctggcttcctgaacctcttatttggttctttgcag
AAGGTTTTCCACAAGCAAGACCGTGGGTCAGGATACCTGAACTGGGAGCAGCTGCACGCT
GCCATGAGGGAGGCAG
gtaggcacaggaagagctggagctgtgggcacacacgggcagggtgcacactcatcaggc
agaggagaggggatgtgtggcatgctgaagtaactctaatacgcagtgttactctcaaag
acgtagatctgcagtcaactccaacattttttatgattgtccctgtgatcctagccaaca

 3.03 Intr +  41572  41688  117  2  0   47   98   208 0.936  18.14
attaaataaaataaattggttaaacaattaaaccattcaaaatgaaccctataaaagaag
atttccatgctatcaggattcaggtccctaaactggagggacatttgaaggggccttgag
caggaggggagctgggtgcaagcccccaatacccacagcaggagcttgtgctcaatgcag
GAATCATGCTCAGTGATGACGTCTGTCAGCTGATGCTCATCCGCTACGGCGGCCCCCGCC
TCCAGATGGACTTTGTCAGTTTCATCCACTTGATGCTGCGTGTAGAGAACATGGAGG
gtaagctggcgggaagctggggagggccaggtcttcctctgctgccccatgacttcccac
ctgtccctagtttaagcacaagggaggacagccgccatcccagaaacagcagaccaggga
agctgtggggacctccagccaagtgcctgtgaaccctggctgcagatatccaaactcatc

 3.04 Intr +  41976  41991   16  1  1   90  100     0 0.060  -4.00
agcagaccagggaagctgtggggacctccagccaagtgcctgtgaaccctggctgcagat
atccaaactcatcttttcctgacttgttccagagacaaaggcttgaagtggctcacttat
catagatgtggctgcgtgtggtcacatgtaggctgacactgggttccctcacgttttcag
AATGGATGTGGTTAAG
gtgagacatatgggaggaactaattcataatgtttccaatagacacattagctgtattcc
tttctgctgcattttcacagatgtcttccaaaacttaacccaagatggcaaagggatata
cctccagaagccagaggtaagacttgccccaaggaggtggctcatgtcatcttacgtaga

 3.05 Intr +  46017  46210  194  0  2  100   72    62 0.039   4.94
ggtgctagcctcactctcctgagtctaggtatctgcactgtggcaactcaaagatgacct
gtctttgctgacacccttcctccagattctctcctatacccccaaagctgagtactgaag
accagggggcagagcaatctccccactcccaccacgcttccccatcttctgtcactccag
GGGAAGCAGGGGCGGGAAAATAGAGATCTGGGGCAGGAGAAACTGGGCAAGCACCAGGGT
GAAGTCAGCTGAAGGGCTGAGAGTTGACCATCAGCAGTTCTGGAATATCGAAAGCAGAAA
GTCTGCCATGAATAAGAAAAAGTGGAAAGTGCAGCCAAGGAGGAGTGAGAAATCACCTGC
CAGTGCCAAGGAGG
gtgaggtcaaggaatccagaggttgggttgtcaagtccagcccacgcagggaaagcatat
caaagtgaggcctgttccaggctgtcacaatctcaggaaaacaggactctacctgaacaa
gaggagatgaaaatacctaccatttatttatccctggtcttgtttcttctttcatgtttt

Predicted peptide sequence(s):


>CAPN14_1|GENSCAN_predicted_peptide_1|572_aa
MAKHKEEVRKLTVLSPFQEQQRLLRKTHWTVPTTCHVSVATFPMQMEAGAKDFEALLAEC
LRNGCLFEDTSFPATLSSIGSGSLLQKLPPRLQWKRPPELHSNPQFYFAKAKRLDLCQGI
VGDCWFLAALQALALHQDILSRVVPLNQSFTEKYAGIFRFWFWHYGNWVPVVIDDRLPVN
EAGQLVFVSSTYKNLFWGALLEKAYAKLSGSYEDLQSGQVSEALVDFTGGVTMTINLAEA
HGNLWDILIEATYNRTLIGCQTHSGEKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLR
NPWGKVEWKGDWSDSSSKWELLSPKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTP
GLLSQEAAQKWTYTMREGRWEKRSTAGGQRQLLQDTFWKNPQFLLSVWRPEEGRRSLRPC
SVLVSLLQKPRHRCRKRKPLLAIGFYLYRYHDDQRRLPPEFFQRNTPLSQPDRFLKEKEV
SQELCLEPGTYLIVPCILEAHQKSEFVLRVFSRKHIFYEIGSNSGVVFSKEIEDQNERQD
EFFTKFFEKHPEINAVQLQNLLNQMTWSKNLL

>CAPN14_1|GENSCAN_predicted_peptide_2|351_aa
MSELPFTIASKRIKYLGIQLTRDVKDLFKENYKPLLNEIKEDTNKWKNIPCSWVGRINIV
KMAILPKAIYRFNAIPIKLPMTFFTELEKTTLKFTWNQKRARIAKSILSQKNKAGGITLP
DFKLYYKATVTKTAWYWNQNRDIDQWNRTEPSEITPLVYNYLIFDKPDKNKQWGKDFLFN
KWCWENWLAICRKLKLDPFLTPYTKINSRWIKDLHVRPKTIKTLEENLGNTIQDIGMGKD
FMTKTPKAMATKAKIEKWDLIKLKSFCTAKETAIRVNRQPTKWEKIFATYSSDKGLISRI
YNELTQIYKKKTNNPIKKWAKDMNRHFSKEDIYAAKKHMKKCSPSLAIREM

>CAPN14_1|GENSCAN_predicted_peptide_3|152_aa
MSIQEFRDLWKQLKLSQKVFHKQDRGSGYLNWEQLHAAMREAGIMLSDDVCQLMLIRYGG
PRLQMDFVSFIHLMLRVENMEEWMWLRGSRGGKIEIWGRRNWASTRVKSAEGLRVDHQQF
WNIESRKSAMNKKKWKVQPRRSEKSPASAKEX