GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:23:07

Sequence C1D_1 : 23192 bp : 37.31% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +  11062  11138   77  2  2  113   92    64 0.427   7.62
cctatcggtactttggcttctgtataaccagtgagaggaaggactgagtggcagtaacat
ctgttagggttactgggcagcatccccgcaacccaggtactcagtctcagccacacctta
ctgagtggtgaagagaagcaagttttctcatgccctctccgtctgtctctacctctgcag
CCAGTGTTTTAGAAGGAGTATGTGGAAGGGCAAGGAGTACCTATAGAACCCCGGAGGAGG
GTGAGGAGCAGAGCTGG
gtgagttcttttcttctttggaaattttaacatgtacaactttaggcatgttctttaact
tcttttggctcagtttattcatctgtgaggtttagatgaacaagtgcatgtggaatgctt
agagtagtgcctggcacataatcagtgctattcaagagtttgctgctgatatcgtagagt

 1.02 Intr +  16880  17026  147  1  0   45   63   145 0.315   7.21
ttaagaaggggacaaattggaatgtagttaatctagaattaaattttaaaaagatttgtc
ttcaggttttaactcttagtgcctttgaaatacatgatatgacctattgatttttttttt
tggaaactaaagaacaagctctgtctctaatatgaattcaaagaatttaattttttccag
TCAGCCATAATGGCAGGTGAAGAAATTAATGAAGACTATCCAGTAGAAATTCACGAGTAT
TTGTCAGCGTTTGAGAATTCCATTGGTGCTGTGGATGAGATGCTGAAGACCATGATGTCT
GTTTCTAGAAATGAGTTGTTGCAGAAG
gtattttaaaaatgtaatttcctaaaaatgaatttcataaaacagaatgctattttatga
aacatgtggaagaagaaacagattaatgacctatgccccttttcccctttatttcaattt
tattagtgtttgggtatttttaggggggaaacaaaacaaaagaaaactccagccttagga

 1.03 Intr +  17789  17855   67  1  1  107   63    24 0.704  -0.64
aaaacttctttttacaaattattttcagatcatttggttattggattatatgaagtgaaa
aaaacttctttgatacattgtacttggtaaaagtcaaatgttatcagatggtgttcaaag
tttgtgtattttttttctgtctcactttctctctttccctctctctttcttttttaacag
TTGGATCCACTTGAACAAGCAAAAGTGGATTTGGTTTCTGCATACACATTAAATTCAATG
TTTTGGG
gtatgtgtgttactttggaattaattagaaagcaaattacttattgtgtgaaagatgatt
tatttttaaaatgctaacaatttatttacaattatactttataacacttttaatagatac
ttatttttaaatctagatgccagtgagccacacatagatttagtattacatggaaattga

 1.04 Intr +  18156  18211   56  1  2   66   91    67 0.635   2.58
ttatttttaaatctagatgccagtgagccacacatagatttagtattacatggaaattga
ataatttaaagtttaattgtttgtaggactttccttttttgtgaataactagtttcttta
attggaatgttttaaattaatacattcaccattttattccatgaaatttttctcttgtag
TTTATTTGGCAACCCAAGGAGTTAATCCTAAGGAACATCCAGTAAAACAGGAATTG
gtaagattttaatttctttttattttatgtgtttgttgttgtattcctgaggtttgtcac
actacctttgtcacacaaattagggagaacagaattcgagttgaaattatgaaagtgagc
cagaccttattatctttgggtttttttttctcttacctttttcagataattggtattcca

 1.05 Term +  21146  21310  165  1  0   71   32    68 0.314  -3.57
ctatgaactccaggcaagcagggagcgtatttatcctattcatttgcatttcctagcacc
atgcactttaataggcaataaatacatatatgttgaatttaaccaaggtgtacagtataa
taaaattcagtggtggcgaatagcttagtaaatctattgcctttgttttttatctttaag
GAAAGAATCAGAGTATATATGAACAGAGTCAAGGAAATAACAGACAAGAAAAAGGCTGGC
AAGCTGGACAGAGGTGCAGCTTCAAGATTTGTAAAAAATGCCCTCTGGGAACCAAAATCG
AAAAATGCATCAAAAGTTGCCAATAAAGGAAAAAGTAAAAGTTAA
ctttttggttttgatgtacacatattcaaaaagtacatcttccccccccccccccccccc
gcaaaataattctgtggcagggcaaggtttaaatgtgtttcttattaatatgtaaattca
cagtaaatatgtaaagctaaatactttcctctccaaagatcattatctttattgattagc

Predicted peptide sequence(s):


>C1D_1|GENSCAN_predicted_peptide_1|170_aa
XSVLEGVCGRARSTYRTPEEGEEQSWSAIMAGEEINEDYPVEIHEYLSAFENSIGAVDEM
LKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIR
VYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS