GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:23:40

Sequence BARD1_1 : 83489 bp : 36.76% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.03 PlyA -    333    328    6                              -3.24
 1.02 Term -   1565   1002  564  2  0   50   47   588 0.965  44.30
 1.01 Init -   4667   4563  105  2  0   68   51    78 0.281   2.37
 1.00 Prom -   4752   4713   40                              -5.85

 2.01 Init +  10917  11015   99  2  0   64  100    43 0.519   3.41
aaacagaatcaaggcgttgagtcaagtattgccagagaaagccggaaggctacggactgc
atcctgggggtatgcctacatggagaggtaggaaaagcagctaaggaaatgctgaaatag
gcagatcaatgtgtataaaaatattaaaatgcggtggaaggaaaggtttcaggaaagaag
ATGAGGTCAGTGCTGTTTCCCAGAGTGGTCAGAGAGAAGGGGACCAAAAATGCTTTGGAG
AACAGTTTCAGCAGAGTGGAGGGAGTTAAAGCTAGGAAG
gtgaggagatgggagtagctggtatggagcactcatttaagaacttttatctgttcaaga
aagggaagagatggagcagaaggtagaatgggaggtatgatcaaaactgtgttttttctg
tgtcaaaggagagattacctgttcatgtgtagatgcaaatgagagaagaaaggcaagtat

 2.02 Intr +  17618  17716   99  1  0   61   81    80 0.436   3.99
aattagatggtcccaaaagtctcttccagctctggtatgggttacagattcattttacaa
ttttttttgagttacattctgtcagaaatcatgctagaagccaaggatacaagaattaga
aatggcataggttttgtttgaggatagttcatattgagtaagaatcctctctgcctacag
AGGATTGGGTCCTGTGACAAGGAATGTCCTGTGGTGCTTGGGGAAGATGTGGCTTTTCAA
CTGTTACATTACTTACTCAGTCCTACTGGAACCCATCTG
gtgaggccaatgaaggaggagatttatagaattcttattctggaattcacagatgggctt
gtgggggggatcgtgaatccctctttttacatgagtatgtatagattttcatcagatttg
caaaaggtctataaaccccaaaattagaaaaactcttctaactctgaaactttagtcctt

 2.03 Intr +  28005  28176  172  2  1   67  109    17 0.450   0.29
ctgctattgggcttttgaacattttatcatcttgctcttgcctcttggtctaggtaactt
gtgatcttttagaatgctttttaccatttctattactgtaacacttgtcagagccaatat
atttcctcttggatgatagccacataattggctattgtttctactcttttctttccaaag
TTCCTCCTCCACATGGCAGTCAGAGTGGTAATTCTACAATATAAAACATTATATCCCTTT
TCTGCATTGGATGTGAGATCCACAGGACTGTTTCCTTTACATCATTTACATCTCAGCTCA
AAAATCAACTTCTCCTTGATGCCTTCCTTGATGACCTTAATTAAAGTAGCAG
gtgagtgtaaagaagagtatctctcacaaaatctggcactttgtgtacatagagacaatt
ttttttctttttaaaaactctgctgaatctttgtatattctgtctaccctcaatggaatc
tttgtgttttaattcttgattataaatctatatttttcaaatttttaaaaagtattttat

 2.04 Intr +  29334  30283  950  1  2   82   97   571 0.969  47.31
cagtaagtattgaatgagtgaatatctgctatcaaagagttcacactctaggagctgaga
aagaagtacataattaaaagatgatacactttaggggaactgtaaacaaaattcttcggg
agctccatgtgggagcaataaatttcatgtaacagatttctttttctttttttctgtcag
ATTTGAAAGAAGATAAACCTAGGAAAAGTTTGTTTAATGATGCAGGAAACAAGAAGAATT
CAATTAAAATGTGGTTTAGCCCTCGAAGTAAGAAAGTCAGATATGTTGTGAGTAAAGCTT
CAGTGCAAACCCAGCCTGCAATAAAAAAAGATGCAAGTGCTCAGCAAGACTCATATGAAT
TTGTTTCCCCAAGTCCTCCTGCAGATGTTTCTGAGAGGGCTAAAAAGGCTTCTGCAAGAT
CTGGAAAAAAGCAAAAAAAGAAAACTTTAGCTGAAATCAACCAAAAATGGAATTTAGAGG
CAGAAAAAGAAGATGGTGAATTTGACTCCAAAGAGGAATCTAAGCAAAAGCTGGTATCCT
TCTGTAGCCAACCATCTGTTATCTCCAGTCCTCAGATAAATGGTGAAATAGACTTACTAG
CAAGTGGCTCCTTGACAGAATCTGAATGTTTTGGAAGTTTAACTGAAGTCTCTTTACCAT
TGGCTGAGCAAATAGAGTCTCCAGACACTAAGAGCAGGAATGAAGTAGTGACTCCTGAGA
AGGTCTGCAAAAATTATCTTACATCTAAGAAATCTTTGCCATTAGAAAATAATGGAAAAC
GTGGCCATCACAATAGACTTTCCAGTCCCATTTCTAAGAGATGTAGAACCAGCATTCTGA
GCACCAGTGGAGATTTTGTTAAGCAAACGGTGCCCTCAGAAAATATACCATTGCCTGAAT
GTTCTTCACCACCTTCATGCAAACGTAAAGTTGGTGGTACATCAGGGAGGAAAAACAGTA
ACATGTCCGATGAATTCATTAGTCTTTCACCAGGTACACCACCTTCTACATTAAGTAGTT
CAAGTTACAGGCGAGTGATGTCTAGTCCCTCAGCAATGAAGCTGTTGCCCAATATGGCTG
TGAAAAGAAATCATAGAGGAGAGACTTTGCTCCATATTGCTTCTATTAAG
gtaggatgcttactctgaaataccatctcagaatgaggccaactataaagcaatttcttt
gcagtttttgaaaaatggcataggattactaggataattaacctttcacagacatgatac
ttcctctgaaccagagaagccagattcatagggagagcatctctacttcagttggagcag

 2.05 Intr +  53874  53906   33  2  0   99  108    31 0.408   3.70
gaggtttaattggctcatggctccccaggctatacaggaagggcctcaggaaacttacag
tcatggtgggagatgaaggggaagcaggcacatcttacgtggtcagagcaggaggaagag
gcgaggaggtgctgcagccttttaatttatttatttattataatttttttatttccatag
GTTTTTGGGAACAAGTGGTATTTGGTTACACAA
gtaagttttttagtggtgatttgtgagattgtggtgtacccatcacccgagcagtacaca
ctgaacccagtttgtagtcttttatccttcaccaccttcccaccttttccccttgagtcc
gtgaagtctgttgtgtcattcttatgcctttgcatccccatagcttagcttccacttatg

 2.06 Intr +  61664  61795  132  1  0  115   70    28 0.441   3.62
taatgtgcagtccttaaagatggaacctctggaatataccttcccccagccactaccagt
ctcttcttcactcactctttttcagtcacatgggctgccttactgtgtcttgagtccacc
aaacatactctcatttcaggtgtgcagcaccacttgtttagtttttttttttttttccag
GAACTAGATGTTCCCATGGCCAGCTTCCTCACACCCTTCAGACCCAGCTCTAGCATCGTC
TTAGCAGAGAGGGCTCTGTGCCACTGCACAGTAAATAGCAACCTCCCAGTGCTGTCTAAC
CCCCTTCCCCTG
gtgtgttgtaccatactatttctcatttgatgtaatgtatttttattttcttgtgttgtt
ttcccctctcaactagaatataaactgtgtgagggcaggggctggctcttctgtttacta
tagtagccctagcattgagaacagtgtttggcacatactgagtgttcagtgtgtgctgaa

 2.07 Intr +  64989  65121  133  2  1   76   94    65 0.461   5.20
aaaaataaagagaaaaaatttatttaaaaggttctgggtgtagattcaatggaaataatt
gaaaattattagagtaaactaagtaatgaaattcaagcttatatcaagtaacagtctgtt
taatgtctttgtctagtcgtctaatgtttttaacactggtatctccttttatattaacag
ATGAACACTGGGCAGCGTAGGGATGGACCTCTTGTACTTATAGGCAGTGGGCTGTCTTCA
GAACAACAGAAAATGCTCAGTGAGCTTGCAGTAATTCTTAAGGCTAAAAAATATACTGAG
TTTGACAGTACAG
gtgaggattttgaattttgggaggtggggtagaaaaaatgttaaatagatgatccttttg
gagaactacctttgataatttacatatgttttaaccattgggagatggctgtatactttg
catcttgtaatacatctaaattttttttcagtaataaactacttatagacaacaacgtag

 2.08 Intr +  65684  65776   93  0  0   78  101    22 0.395   1.52
tgatggccaggttagagaactagatactaaatagaagtagtcttacacttaagtgtaaaa
attgttgcctttgaagattcagatataagcttacaaaatatagatgagttataagaagca
ggccaaagaaatactttggcttgtatctttctttctcttactgctttttttgtattttag
TAACTCATGTTGTTGTTCCTGGTGATGCAGTTCAAAGTACCTTGAAGTGTATGCTTGGGA
TTCTCAATGGATGCTGGATTCTAAAATTTGAAT
gtaagtgttggatttgagagaattaagaaatgaattagactagttttgtttttcatggtt
attaatgcctgtgattaaggaacttgatgttaattttcttacctctggttagtcactgca
ttttggaaaagcttctggctgggcgtggtggctcaagcctgtaatcccagcactttggga

 2.09 Intr +  80335  80432   98  2  2   60   28   115 0.891   1.51
gaaaaccagttgtattacattttgttttggcataagtaagatttctgtttgcattttaga
ataatacttaaaaactgccatgaagaagaaaaaccacttaggtaaattgcttgattttaa
tgagagagatatagtgctcacttgatacttagtttgctttaattcttgtgtttttgtcag
GGGTAAAAGCATGTCTACGAAGAAAAGTATGTGAACAGGAAGAAAAGTATGAAATTCCTG
AAGGTCCACGCAGAAGCAGGCTCAACAGAGAACAGCTG
gtatttttcttttaatacaactttcattgttcttattatgacatactattattatcacca
tcaggaagaacttctgccctttcaacagctacaggtgactgattaaaattttaattgtgc
ttatttcaagcacttgattctgaaagatgatcacgatgagcagtaaaatccagaaggtaa

 2.10 Term +  81835  82167  333  0  0   81   42   220 0.975  10.33
tacctcatgtatatgcaaattttccaaaacccaaaaaatttatgaatctgaaatgcttct
cctccaaatgtttcaggtaagggatattcaacttgtatttttattttcctcattcatata
cagtgtttttgaatacagtattttgatctgcctttaacaaatgttttctcattatttcag
TTGCCAAAGCTGTTTGATGGATGCTACTTCTATTTGTGGGGAACCTTCAAACACCATCCA
AAGGACAACCTTATTAAGCTCGTCACTGCAGGTGGGGGCCAGATCCTCAGTAGAAAGCCC
AAGCCAGACAGTGACGTGACTCAGACCATCAATACAGTCGCATACCATGCGAGACCCGAT
TCTGATCAGCGCTTCTGCACACAGTATATCATCTATGAAGATTTGTGTAATTATCACCCA
GAGAGGGTTCGGCAGGGCAAAGTCTGGAAGGCTCCTTCGAGCTGGTTTATAGACTGTGTG
ATGTCCTTTGAGTTGCTTCCTCTTGACAGCTGA
atattataccagatgaacatttcaaattgaatttgcacggtttgtgagagcccagtcatt
gtactgtttttaatgttcacatttttacaaataggtagagtcattcatatttgtctttga
atcaaaaaaaaaaaaaaagtctaatgccagattaggaattcatgttatgtttaccattta

Predicted peptide sequence(s):


>BARD1_1|GENSCAN_predicted_peptide_1|222_aa
MPGYVPIHPHQQVMLAAKQIHVQHKADVSCKLNVRVLTARRPDCSAGTEGGNGRFEKILP
PPETVRPVPSQPPPRSSVFTNASSAAASPGGRARRDCGPRHRDHPVPWRARNEARSRSGS
SAAGSSAADYPASSRLRMKGSSQSGKQGSLGKPQGSCRPATRNRPSSSRVWDGGPPEGRG
ARGGAGHGGRNAPKIGTRRAQGRGRESQPLAEWAGPRGGAGG

>BARD1_1|GENSCAN_predicted_peptide_2|713_aa
MRSVLFPRVVREKGTKNALENSFSRVEGVKARKRIGSCDKECPVVLGEDVAFQLLHYLLS
PTGTHLFLLHMAVRVVILQYKTLYPFSALDVRSTGLFPLHHLHLSSKINFSLMPSLMTLI
KVADLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQD
SYEFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQK
LVSFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVV
TPEKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIP
LPECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLP
NMAVKRNHRGETLLHIASIKVFGNKWYLVTQELDVPMASFLTPFRPSSSIVLAERALCHC
TVNSNLPVLSNPLPLMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEFDSTV
THVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRSRLNR
EQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHA
RPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS