GENSCAN 1.0	Date run: 15-Jan-104	Time: 21:49:58

Sequence ATF2_1 : 96289 bp : 36.22% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    967   1129  163  0  1   78   81   157 0.703  13.96
cccctcacaccgccaaagccctgcctagcccttcaccgccgcctgcacccgcgccctcct
ccagccgacagccaatcacagtcttccacagctccgggtttacagaagtaacgctccttg
ggccctctggtcccgccccctccagaactgcttcccgcccttcgggctccttgtccaatc
ATGAGCGCCCGAGTGCTCTTTGATGCCCGTCCCCTCTACCCGCCCTGCCGAAGACCCGCC
TTCTTCTCCTTAAGCCTGACGGAATCACCTGACTCGGAGGCGCTCCCTCAGAAGGAAGGC
AAGAAGGGGCGTGTGGGTGAAGGGGAGGGGCGCCAGAAGGAAG
gtggggatgccgggagcggggcgagcgggcgggggttgtcagtccgatctcgcgagagag
gacggaagcctgtgggagcccgtggcctttaaagtgccgttcagccttttcctccagggg
tgctttgtaaacacggctgtgctcagggctcgcgggtgaccgaaaggatcatgaactagt

 1.02 Intr +   1462   1549   88  2  1   62   59    66 0.101  -0.79
cgggtgaccgaaaggatcatgaactagtgacctggaaaggtgagtaacgatgggcagagg
tcagcagggctggagactgtagggatacggagaaagaaggcgctaacatggcgacgtcgc
tcagcacagtccccaccccccgtttcccatcacctcgggtgctcctgacgtgctccttag
CCCTTGGGGCGATTGTGGCTGTGCTGCCACCTCGGCGGCCCGCGCGGTGTGGGCTTTGGG
AACCTGACTGGCTGGGCCGGACCGTTAG
gtaaccagcgttcgttgttccggcccctccctctcgcgcgctttcctaaggcagaggaaa
aaggaataacggctccctcttagacccctccctccgaattatcttcaccctacttgggtc
agttcagaggtcctcggggcgcgcgtcgagtcagccgtgtgcgcagggagacctctccca

 1.03 Intr +  39163  39232   70  1  1   75   90    46 0.280   1.77
gttacatgtattttatctactctcataataagaaagatagaattaaaatgtcagaaaagt
gttttattttgtattaaaatagaaaagttaataagcttaatgaaaaatcttgagatttat
attttaaattattctttattttaaaatatgtactctaaagtgtcttctgtttgattatag
GCAATACAAGGACCTGTGGAATATGAGTGATGACAAACCCTTTCTATGTACTGCGCCTGG
ATGTGGCCAG
gtaatatataaattactttaaattattttgtatatttccacttattaaaacattgatgat
ataatatgttatcactaaaagtattttcttacagtattctgtaaaattttagagttagga
tgaaaaaaaacccaggaaacttttggcaagaaattctgctttttcttcaatagtgcaact

 1.04 Intr +  47830  47926   97  0  1   66   53   121 0.879   5.06
ctgtgattgtttgcaatctagtgtgctatctactaacaataacggattcttttatagttt
aaaaactgctatttcactgttaatggtggttttacatgttgtggaaattaatttcctaat
cattttacttatttgatcaaattgaaaatcttaactatattttaaaactttttgccacag
CGTTTTACCAACGAGGATCATTTGGCTGTCCATAAACATAAACATGAGATGACACTGAAA
TTTGGTCCAGCACGTAATGACAGTGTCATTGTGGCTG
gttagtatatgcttttattaatagcttgtatacatatttcacctggaatgtgcacaattt
ttgtgtattctctgtaaataatatagtctggtgatattccaatgacttcattatagtaaa
tgttggcaacatgtattttacccattacattttcatgtttccttctgactattcatttca

 1.05 Intr +  51001  51119  119  2  2   71   53    92 0.973   3.26
ggaaatacgaagtacaacaaaaatttaaccaaattttgtttgttttaaaggaagaggtct
ttccaaagagagaattaacaactgactgaaccagtcctgctaatttgttaacttagtagc
tatattttagagtcttaacatatttaaatatgcatgattacttcttgacatttatttcag
ATCAGACCCCAACACCAACAAGATTCTTGAAAAACTGTGAAGAAGTGGGTTTGTTTAATG
AGTTGGCGAGTCCATTTGAGAATGAATTCAAGAAAGCTTCAGAAGATGACATTAAAAAA
gtatgttgtaaccatgaaatttaaaaagagtacttctgacagaaaagtaatcatagttta
tacttcctgctttttaaatttagacacactgtttttgaacttataaccttttccttatta
tttgaattatagatgcctctagatttatcccctcttgcaacacctatcataagaagcaaa

 1.06 Intr +  51252  51380  129  2  0   65   72   115 0.985   7.57
ccatttgagaatgaattcaagaaagcttcagaagatgacattaaaaaagtatgttgtaac
catgaaatttaaaaagagtacttctgacagaaaagtaatcatagtttatacttcctgctt
tttaaatttagacacactgtttttgaacttataaccttttccttattatttgaattatag
ATGCCTCTAGATTTATCCCCTCTTGCAACACCTATCATAAGAAGCAAAATTGAGGAGCCT
TCTGTTGTAGAAACAACTCACCAGGATAGTCCTTTACCTCACCCAGAGTCTACTACCAGT
GATGAGAAG
gttagaaatttttagaaatacaaagtaagggggaggaacagtacccaaataaagtttact
atttaatctccataaaatgttaatgtattaaattcagtgtcagcttgcaatagttttata
tgtgaaagcctgtcaatactcagatatttcagggtaagaagactgcagcttttattgtac

 1.07 Intr +  54502  54680  179  0  2   71   75   106 0.482   5.40
aacattgcatttgaatctttacagctcttctaaaatgttcttttaattaatttgagatat
taatttgcttttagcagttattattctgtagatgcttttagaagtgtgttacattctgtt
cactaaggtacatgatttgtatttttaaatgccacccttttttatctcattgttaaatag
GAAGTACCATTGGCACAAACTGCACAGCCCACATCAGCTATTGTTCGTCCAGCATCATTA
CAGGTTCCCAATGTGCTGCTTACAAGTTCTGACTCAAGTGTAATTATTCAGCAGGCAGTA
CCTTCACCAACCTCAAGTACTGTAATCACCCAGGCACCATCCTCTAACAGGCCAATTGT
gtaagtgattcaggccaatcattgaacatatacatgaattaagtttgttttgtaatgatt
tttcctaagacatttgattattcaaactaagatcttagttttgtatgtgtgtgcatgctt
cgaattttggaaaaagtacttgcgtagtcttctttaatataaatattaactaacagagtg

 1.08 Intr +  55262  55376  115  2  1   91   63    38 0.321   1.13
tacacaggttatgcatttaagatgcaattaaaaataattaaattttgctatttgctttgc
tgtggttagaaaatgtatttttaaatgatatgattataggagtaaaaatactattgtatt
tttaagagacagttggtatgaatctcttttttaaaatttctcttcttttgtttttcttag
CCCTGTACCAGGCCCATTTCCTCTTCTGTTACATCTTCCTAATGGACAAACCATGCCTGT
TGCTATTCCTGCATCAATTACAAGTTCTAATGTGCATGTTCCAGCTGCAGTCCCA
gtaagaaagttagactatttaaatctctatcgcaaaactgatctttgtagtcagaaaata
aagttggctgcttgactggcttatgaaattgaatttaacataatattgattagcagttga
tagtatttatttgttatcattgtaatagcatataccattcaaggtatagctattttttct

 1.09 Intr +  57716  57802   87  1  0   40  103    49 0.202   0.85
ttttgaaggataagtcaggatataagaccaaataaggatttggtatagagataaaatcag
ctggtgataaatttacaatgttctgattcttaaagtctcaaattattacaacagcagtaa
agtacaaatctcattttgaatatattctctagcaattatttttccttatgtcatgcatag
CTCGTTCGACCAGTCACCATGGTGCCTAGTGTTCCAGGAATCCCAGGTCCTTCCTCTCCC
CAACCAGTACAGTCAGAAGCAAAAATG
gtaagccagattttatttgttctgtacattgcttgaggctgttttgaattaatgttttca
ctaaagcctgcttcaaatgcacaatttagatcacatttttataaagttacggactgtttt
atactatagataaaccacaaaatttgaaaaaagaaatcttcctttagcatagtgagtagt

 1.10 Term +  58077  58121   45  2  0  109   49    35 0.836  -2.07
atttttataaagttacggactgttttatactatagataaaccacaaaatttgaaaaaaga
aatcttcctttagcatagtgagtagttagtgatactttaaaattagtggcagattagaag
ttctgtttcttgtcacttgttgtttgtctggctttttcttgtggctttttctcctcctag
TGGAAAATAGGAGTATTACATCTGAAACTAGATGTGATCATCTGA
aggcagtgctgctaataatgatgagtggttttaacagtattaaaaagaattctgaaatag
tgtacaagttagcaaacatgataaaaccatttttttctgttgtgctgtttggatgctatt
aaattaatgtttagatgtgtattttaattttaattttaatcctaactccactattcacta

 2.01 Init +  61728  61856  129  2  0  104   27    83 0.856   4.00
ccgaggctggcagatcactcgcggttaggagctggagaccagcccggccaacacagcgaa
accccgtctccaccaaaaaaaatacgaaaaccagtcaggcgtggcggcgcgcgcctgcaa
tcgcaggcactcggcctgctgtggcaggagaatcaggcagggaggttgcagtgagcagag
ATGGCGGCAGCACAGTCCAGCTTTGGCTCGGCATCAGAGGGAGACCGTGGAAAGAGAGGG
AGAGGGAGACCATGGGGAGAGGGAGAGGGAGACCGTGGGGAGAGGGAGAGGGAGAGGGAG
CCACAAAAC
gtacttctatgaggatatctgctcagcaattgtctgtctcatacacattcttatgtaact
ttcatggccatatattttcattttattgactaaacagctaaaagtagaatcgccgagtca
gagggtaggtatacatttaactttataagaaattgctaaacctttacccaaaggtttaca

 2.02 Intr +  71777  71926  150  1  0   50   96   119 0.937   8.34
tttaaggcctttattattattttctcaaaattcactaggaacagcaaaatacagaatcct
ctagtagtactaggcaaaaggactcagggaaactacccaaggtgctattgtttgtcttgt
tgatattcatgatgatctttaaggacttaaaaaaaatttttaatggtgtttgcattgcag
AGATTAAAAGCTGCTTTGACCCAGCAACATCCTCCAGTTACCAATGGTGATACTGTCAAA
GGTCATGGTAGCGGATTGGTTAGGACTCAGTCAGAGGAATCTCGACCGCAGTCATTACAA
CAGCCAGCCACATCCACTACAGAAACTCCG
gtatgtgtgttgtttttattattcagcactctgtcatctttaaacagaaaagtacagtgt
aacttacggcttatttaaaaaatattactctggtcatgttgttattccaaagatgtatca
aaagcctcaggaaaaggtagctcagtatacaagtattgatacaaaaataaacataataga

 2.03 Intr +  76103  76309  207  1  0   66   80   234 0.775  18.75
ataagtatattcaagaaggaagttaaaccacagggtgattttcatattgccccaacatac
tgatgtattcaacaagacttagaaaatacagttgctctccccctttgacaccctttactg
cctatgttaattcactcactagatacaaatataacaggctttcatctctgtttataatag
GCTTCTCCAGCTCACACAACTCCACAGACCCAAAGTACAAGTGGTCGTCGGAGAAGAGCA
GCTAACGAAGATCCTGATGAAAAAAGGAGAAAGTTTTTAGAGCGAAATAGAGCAGCAGCT
TCAAGATGCCGACAAAAAAGGAAAGTCTGGGTTCAGTCTTTAGAGAAGAAAGCTGAAGAC
TTGAGTTCATTAAATGGTCAGCTGCAG
gtatggtgcatatatgtgaattttgttttatttcttttttaataattgtgaacatagatt
ttttttttcctagttgggcctccaaacattttaggacatgatattgggtgtgtatggaat
ctatagtaaatcatagttttgtaaacctgtttgtttggatgctgagatgaaataatataa

 2.04 Intr +  88605  88710  106  2  1   49   73    86 0.002   2.07
taataaatgctaaaatataaaagctgccctgtgctgattagacatatttaatcagcatat
tttctttgtttttaatgttctgccagtgatgtccaattttatactttaatccttgcttgt
tttaaatagtaaaaaatatgtttagtctgtggtaaggtacataagttgtttcttctccag
AGTGAAGTCACCCTGCTGAGAAATGAAGTGGCACAGCTGAAACAGCTTCTTCTGGCTCAT
AAAGATTGCCCTGTAACCGCCATGCAGAAGAAATCTGGCTATCATA
gtgagtaatgttccattacctatagccttaggctacgtcagtgaaataccgtcagagtga
actgagctgctactttaaaaatggagactgtgcttctaatattcaagattaaatatcaga
atttctgtaaggttattatagaatgcagtagagaggtataattttttagaatctagagag

 2.05 Term +  94535  94761  227  0  2   80   38   187 0.807   8.86
ttttgacctattgcaggtaaaattgcctacttcatgacctatatcaattgctgtaatacc
aacttgtctaatcagttttgtaagatactttctaactttttactctgtgtattgcctcag
catactggtgcattcttaccgattttaggaaaatgaataatttttcttttttccacccag
CTGCTGATAAAGATGATAGTTCAGAAGACATTTCAGTGCCGAGTAGTCCACATACAGAAG
CTATACAGCATAGTTCGGTCAGCACATCCAATGGAGTCAGTTCAACCTCCAAGGCAGAAG
CTGTAGCCACTTCAGTCCTCACCCAGATGGCGGACCAGAGTACAGAGCCTGCTCTTTCAC
AGATCGTTATGGCTCCTTCCTCCCAGTCACAGCCCTCAGGAAGTTGA
ttaaaaacctgcagtacaacagttttagatactcattagtgacttcaaagggaaatcaag
gaaagaccagtttccatttatgcgaaatctgtggttgtaaattttttttttttacttgaa
attaaatttggctctaaagttggtgtagcagcagttgatcagactgaaaaacggttttta

Predicted peptide sequence(s):


>ATF2_1|GENSCAN_predicted_peptide_1|363_aa
MSARVLFDARPLYPPCRRPAFFSLSLTESPDSEALPQKEGKKGRVGEGEGRQKEALGAIV
AVLPPRRPARCGLWEPDWLGRTVRQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKH
KHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKM
PLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPA
SLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTM
PVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMWKIGVLHLKLD
VII

>ATF2_1|GENSCAN_predicted_peptide_2|272_aa
MAAAQSSFGSASEGDRGKRGRGRPWGEGEGDRGEREREREPQNRLKAALTQQHPPVTNGD
TVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDE
KRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLL
AHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVA
TSVLTQMADQSTEPALSQIVMAPSSQSQPSGS