GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:22:22

Sequence APOB_1 : 45044 bp : 42.92% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1329   1468  140  2  2   77   36   397 0.903  31.06
gcgctcttgcagcctgggcttcctataaatggggtgcgggcgccggccgcgcattcccac
cgggacctgcggggctgagtgcccttctcggttgctgccgctgaggagcccgcccagcca
gccagggccgcgaggccgaggccaggccgcagcccaggagccgccccaccgcagctggcg
ATGGACCCGCCGAGGCCCGCGCTGCTGGCGCTGCTGGCGCTGCCTGCGCTGCTGCTGCTG
CTGCTGGCGGGCGCCAGGGCCGGTGAGTGCGCGGCCGCTCTGCGGGCGCAGAGGGAGCGG
GAGGGAGCCGGCGGCACGAG
gttggccggggcagcctgggcctaggccagagggagggcagccacagggtccagggcgag
tggggggattggaccagctggcggcccctgcaggctcaggatggggggcgcgggatggag
gggctgaggagggggtctccggagcctgcctccctcctgaaaggtgaaacctgtgccggt

 1.02 Intr +   2736   2913  178  0  1   84   86   159 0.990  14.30
cttccctgtgcctcagatgagatattcaagacatgccagccaatttaaacattagcctca
gcaaaaacataatggagaagtcaaatctataaaggaaaattaagtataaagtcaattaaa
aaataatttgagttgaattaccatttttaattctctatgccactgcccctctctgcccag
AATTGGCTGTCCTTGGGAGAGCTATTTCTGCTATGTGGCTGACGTATTTCTCCCCACGTT
AGAAGATGCGACCCGATTCAAGCACCTCCGGAAGTACACATACAACTATGAGGCTGAGAG
TTCCAGTGGAGTCCCTGGGACTGCTGATTCAAGAAGTGCCACCAGGATCAACTGCAAG
gtatggaggatgcaggcaggagggacctagagcccacagctttcccccagccctgttcca
gcgggcgcccaacacgcgaccttcccggagggtgtgtactgagcaaacgcagaacatccc
agaactgttgtaatctgatcaaagcactgggactttgcctctgtttgtaagtcagccaca

 1.03 Intr +   4191   4336  146  2  2   68  111   166 0.812  15.06
ggttggtgcacagagaacccaggaggcatgttgataaggcatgtggtgttgaggcgcagg
cagtggtgttcccagcaccattccctttggtgctctgattagagattaagccctgggctt
caggggccacctctcattcttgatagacaacctcaatgctctgctaccctgaattctcag
GTTGAGCTGGAGGTTCCCCAGCTCTGCAGCTTCATCCTGAAGACCAGCCAGTGCACCCTG
AAAGAGGTGTATGGCTTCAACCCTGAGGGCAAAGCCTTGCTGAAGAAAACCAAGAACTCT
GAGGAGTTTGCTGCAGCCATGTCCAG
gtaagtcatgttgtacatgagcacacgcatgtgtgtgtgtccgctgaggtatgaacttgt
gtgtttgcaccaggcacggatgtgactgtaagtatttgtattccgtatccatcgtggatc
agggaattactgagttttcacaatcatcaaaaagagagaagcattagttaaccttcccta

 1.04 Intr +   7163   7316  154  2  1   84   81   181 0.997  16.15
gcatacttttttgaaaatgtatgtctatgtgtagctatattctatatttacaaataaatg
atgtcagaagaacaattggttaaaaaaatatgagaaaagaaacttcagtgccacccagct
tacttccagcaagttgtaatggagaaggacatttccgtgaccatcctctctctgggacag
GTATGAGCTCAAGCTGGCCATTCCAGAAGGGAAGCAGGTTTTCCTTTACCCGGAGAAAGA
TGAACCTACTTACATCCTGAACATCAAGAGGGGCATCATTTCTGCCCTCCTGGTTCCCCC
AGAGACAGAAGAAGCCAAGCAAGTGTTGTTTCTG
gtgaggatttagaaagctgatagcagtggcccttgaaactcatcttcatgtgttagagac
cagtcctaccatatacaaagcagatcactgagtcagctccatgactagttacataggaag
ccctggattggcgtgaaatactggtgcccgaggttcctcctgccccttaggctcactgac

 1.05 Intr +   8019   8174  156  2  0   99  115   228 0.999  25.89
tcccaacttgggctggccaggcactagcaagaccacactctgcataggaagaaaaagaaa
gtccctcccaaagctagattccttctgctttttctttcacgatccccaccccatccctcc
caagtacccaaggatgttgcccgtgttgaatacatgtggttgcatcttcttcctccatag
GATACCGTGTATGGAAACTGCTCCACTCACTTTACCGTCAAGACGAGGAAGGGCAATGTG
GCAACAGAAATATCCACTGAAAGAGACCTGGGGCAGTGTGATCGCTTCAAGCCCATCCGC
ACAGGCATCAGCCCACTTGCTCTCATCAAAGGCATG
gtaagtcccatgtcagcactgtcgtgcacagcaaggagcatcctcttattaatacaattc
cagaacttttgagctagtgggcacctttgaggacagcctgccctggctgttttttataca
gactagagataggaccctgagcaggcacgggaaggtctgcccaggcttcacggcctggga

 1.06 Intr +   9566   9690  125  1  2   82   58    75 0.996   2.36
cagctttggggatgccgacttgttgcaccccctggtctaaatgtcaagtacccagttatc
ttctttctctgagtttatctagtggtacaggactcctgctcccttctaccttgaaggtaa
atgcttttaacagaagatacagggactgatcaaaatgctcgtctccaatctctttcatag
ACCCGCCCCTTGTCAACTCTGATCAGCAGCAGCCAGTCCTGTCAGTACACACTGGACGCT
AAGAGGAAGCATGTGGCAGAAGCCATCTGCAAGGAGCAACACCTCTTCCTGCCTTTCTCC
TACAA
gtaggtcatgtgatgcacccctgatttgtcatttaatgggtcagtgtgaactgaacactt
ctcaagtgctctgttccaggcaaacctgtgcctgggagggaggaatggagagggataaaa
tgccgcccctccctgtccccctttttaagcgaacaggccatttggcagaaaagtcctagg

 1.07 Intr +  10373  10458   86  2  2   76  116    82 0.997   8.34
taactagcgtgaccaggaagaggtggatgttattcattcagggccaacaatggctggatt
tacccatgctttgaaagatgggcaggacttgggtagatgcagagacagggaaaaccttca
acatggaaagaatagtatgttctggccatccgtgacatggtgtgcttccttggttaccag
GAATAAGTATGGGATGGTAGCACAAGTGACACAGACTTTGAAACTTGAAGACACACCAAA
GATCAACAGCCGCTTCTTTGGTGAAG
gtaagagtttctgtccacatagttgctggaaaatctactcaagatgtgcctatcatggct
tagccacttgctgagccctgttaaatgtctgctgactaacaagtgatacagacactggtg
ttctggctacctctagtgagaaagcaaactcatttcatgatgtcaagttgcaatggcata

 1.08 Intr +  11756  11975  220  0  1   74   70   233 0.998  16.54
tgagtcagtgaaaacaagtcaatcacctatggcagagccagatctagcaggcattgaata
caggatagtttctttcccttttcccctgtgctgatactccacaatttccagcttccagta
gacaaagatatggttgagatgaagaaagctagagttcctttgacactttccatcttccag
GTACTAAGAAGATGGGCCTCGCATTTGAGAGCACCAAATCCACATCACCTCCAAAGCAGG
CCGAAGCTGTTTTGAAGACTCTCCAGGAACTGAAAAAACTAACCATCTCTGAGCAAAATA
TCCAGAGAGCTAATCTCTTCAATAAGCTGGTTACTGAGCTGAGAGGCCTCAGTGATGAAG
CAGTCACATCTCTCTTGCCACAGCTGATTGAGGTGTCCAG
gtatctaatggttacagctcaactttttataaaactgatggtaactgactgaactttcaa
accttggccaaatggagaatctcagggaccatttggatatcaatccagttaatcaattag
tcaatcagttcatgattgctggatagagaactatcagctgctgcgctgagttccatgaaa

 1.09 Intr +  12693  12920  228  0  0   91   89   281 0.991  24.56
tctgtgggtaatattcctaaggaaagcatcatggttctgagctccaagttgggttttgaa
gttagatttgaatagtgaatgaggtgattaagggctctcctggcagaggacacaccatga
gcaatattttatgtgccctgaaggtggtctgtataactttatccatgtctttcttctcag
CCCCATCACTTTACAAGCCTTGGTTCAGTGTGGACAGCCTCAGTGCTCCACTCACATCCT
CCAGTGGCTGAAACGTGTGCATGCCAACCCCCTTCTGATAGATGTGGTCACCTACCTGGT
GGCCCTGATCCCCGAGCCCTCAGCACAGCAGCTGCGAGAGATCTTCAACATGGCGAGGGA
TCAGCGCAGCCGAGCCACCTTGTATGCGCTGAGCCACGCGGTCAACAA
gtgagtttccacactgtatttctcctcctaggagcagaggaacatcttgcacctctgtgc
atctctgtattaaaactgaacccctccttccactttcaaactctgctccttactcttgtg
ttttttcttgatcatttttggggtaatgacttgaaataagaaatcagcaaacacaaattg

 1.10 Intr +  15259  15376  118  1  1  105   56   137 0.999  11.75
gaagtcaggtaatgtgatgcctccagctatgttctttttgcttaaaattgcttcagctat
tcaggctctttttggattccatatgaattttataattattttttctaattcacaagtttg
ggttttaagacaaacctaactggggttaccaagtcctgactctcttctcttattctgtag
CTATCATAAGACAAACCCTACAGGGACCCAGGAGCTGCTGGACATTGCTAATTACCTGAT
GGAACAGATTCAAGATGACTGCACTGGGGATGAAGATTACACCTATTTGATTCTGCGG
gtaatctcagtcttttatatgacatacatcatttcagaagcacttttcctggacaccttt
tacttccctctcctgcaccctgatgggttcttgtttcttttcttcaatgcaggtcattgg
aaatatgggccaaaccatggagcagttaactccagaactcaagtcttcaatcctgaaatg

 1.11 Intr +  15489  15635  147  2  0  109   98   208 0.996  23.41
attacctgatggaacagattcaagatgactgcactggggatgaagattacacctatttga
ttctgcgggtaatctcagtcttttatatgacatacatcatttcagaagcacttttcctgg
acaccttttacttccctctcctgcaccctgatgggttcttgtttcttttcttcaatgcag
GTCATTGGAAATATGGGCCAAACCATGGAGCAGTTAACTCCAGAACTCAAGTCTTCAATC
CTGAAATGTGTCCAAAGTACAAAGCCATCACTGATGATCCAGAAAGCTGCCATCCAGGCT
CTGCGGAAAATGGAGCCTAAAGACAAG
gtaaagtccacaagaagaggtctgaaagtgaaagtttattaacaaggatttggaaggtac
taggggaatgagactctagatttcatctactgactttattctgctgtttctttcctttcc
ttccttccttccttccttccttcctccctccctccctttcttctttccttccttccttcc

 1.12 Intr +  16736  16947  212  1  2  109   89   160 0.994  14.99
ttacttgatagtgctctaggaaacactggcaagaagattcaataccagcatttgaagaac
gattacagagaaattagacctgtgcttaagaaagagctagcagacaatgccagtgtttgc
caggcatgttctgtgttctgaccacaggacagtgataaccatctcctcttttgactgcag
GACCAGGAGGTTCTTCTTCAGACTTTCCTTGATGATGCTTCTCCGGGAGATAAGCGACTG
GCTGCCTATCTTATGTTGATGAGGAGTCCTTCACAGGCAGATATTAACAAAATTGTCCAA
ATTCTACCATGGGAACAGAATGAGCAAGTGAAGAACTTTGTGGCTTCCCATATTGCCAAT
ATCTTGAACTCAGAAGAATTGGATATCCAAGA
gtaagtaagagctattcaccccatataccactgagggccctgagctggaattccaaccct
aggttttggcatagccactgtctgcccttgcttctgaaacaaacacttgtgcaaatgtgt
agcagatctagacccaaagacttagggtcaatgaaatcaagacattttggtagtgattgg

 1.13 Intr +  17209  17446  238  1  1   69  107   179 0.998  14.59
ctgcccttgcttctgaaacaaacacttgtgcaaatgtgtagcagatctagacccaaagac
ttagggtcaatgaaatcaagacattttggtagtgattggaaatccatatttacttggggt
gcaagagtcaaaggataataacatggtgtgtcagctcaaaatatacttcttcttatctag
TCTGAAAAAGTTAGTGAAAGAAGCTCTGAAAGAATCTCAACTTCCAACTGTCATGGACTT
CAGAAAATTCTCTCGGAACTATCAACTCTACAAATCTGTTTCTCTTCCATCACTTGACCC
AGCCTCAGCCAAAATAGAAGGGAATCTTATATTTGATCCAAATAACTACCTTCCTAAAGA
AAGCATGCTGAAAACTACCCTCACTGCCTTTGGATTTGCTTCAGCTGACCTCATCGAG
gtaagtgtgaagagtttgaggttctctagcccattttgtacagcatcataaacagagagt
ccctgggagccaggagctacccagaggaaaactaagaaccaccaggcacttcctaccatg
attctgaggctttcttctttccctccttccccgccttcctctctccccgctaggggtcac

 1.14 Intr +  18310  18486  177  0  0   96   89   193 0.977  19.39
ataaggtcaagattctagtgagattttaataaagcagctcctgtgaaatgctaaggtcag
ctcctggcctgtggtattcaaatacttgtttagataaatggacatcaagagtggggacta
ctaggctggcatacaacaaagaaacctgatgccattttcttgtctgattttctttctcag
ATTGGCTTGGAAGGAAAAGGCTTTGAGCCAACATTGGAAGCTCTTTTTGGGAAGCAAGGA
TTTTTCCCAGACAGTGTCAACAAAGCTTTGTACTGGGTTAATGGTCAAGTTCCTGATGGT
GTCTCTAAGGTCTTAGTGGACCACTTTGGCTATACCAAAGATGATAAACATGAGCAG
gtgtgtatttgtgaagtatcttcttaaggaaagctttgggtctcaatgcaaaaacaattc
ttttctaagcatggaagtcctcaaaatactatctaactgaagggataactatggttttta
tcaaccagacctgctggggtaagggccagtatcctctgcagttaaagatctcctgaattc

 1.15 Intr +  20150  20341  192  1  0   56  115   189 0.988  17.17
agaccttagttctttaatctctgcttagaggaattagcctggacttcagtgtctccctgt
tcctcacctggagcattttttaggcccatcctggctgcatcagacaggtcccacattggg
aactgaaaggtgtttgacattgctgacatctcactggccattttattactaaactctcag
GATATGGTAAATGGAATAATGCTCAGTGTTGAGAAGCTGATTAAAGATTTGAAATCCAAA
GAAGTCCCGGAAGCCAGAGCCTACCTCCGCATCTTGGGAGAGGAGCTTGGTTTTGCCAGT
CTCCATGACCTCCAGCTCCTGGGAAAGCTGCTTCTGATGGGTGCCCGCACTCTGCAGGGG
ATCCCCCAGATG
gtaagtcagcaggccccactgggggcccatgagaccagacgttggtttttttttagatcg
cccagactcccttacgatcccagctgcacaagcccgaaaagatgcttgtactttcttcag
agatggaggtttgccttgaatttcactgaagatgactcttggatcacatggaaatgttaa

 1.16 Intr +  21582  21749  168  2  0   70   74    99 0.981   5.92
tgaaaacggtaaaaacatcagtttgatctttatttatcaaactattcagctcatcaaaat
atgctagtccttcctttccagataaagaggaattactctccaatgtatgggaggttgtaa
ttaacaaaaccgactttaaaaagacttacttttatttgctctcccttgttgggtctacag
ATTGGAGAGGTCATCAGGAAGGGCTCAAAGAATGACTTTTTTCTTCACTACATCTTCATG
GAGAATGCCTTTGAACTCCCCACTGGAGCTGGATTACAGTTGCAAATATCTTCATCTGGA
GTCATTGCTCCCGGAGCCAAGGCTGGAGTAAAACTGGAAGTAGCCAAC
gtaagattctgtttgccttttgatttcttaggttattactttcttccagggtgcatttct
tgttaaaacatatttaaaaatgtgtttccacttcaagacaaaatgcttcatcattgtaat
cacctcattatttttttatgaaaaacttcaagcttccaccagaatgcactacctcactag

 1.17 Intr +  22232  22443  212  1  2   53   53   190 0.643   8.79
tactccaactctagagaactgagaactcgctttccttcttccaaacaaatcccagtaatg
tttccaaaggtctgagttatccaggaaatctttgcccggaggtgagaaagggtggttgat
ctgactgacaggggactgaagtatttaatgaatctgaataggttgttttctgacttatag
ATGCAGGCTGAACTGGTGGCAAAACCCTCCGTGTCTGTGGAGTTTGTGACAAATATGGGC
ATCATCATTCCGGACTTCGCTAGGAGTGGGGTCCAGATGAACACCAACTTCTTCCACGAG
TCGGGTCTGGAGGCTCATGTTGCCCTAAAAGCTGGGAAGCTGAAGTTTATCATTCCTTCC
CCAAAGAGACCAGTCAAGCTGCTCAGTGGAGG
gtaattctttcagccaagtctgcctagccagtttgaaagagagaacagagaatgtacctg
cagaattttgccaggctaaacagttgattgagatcattcaggtcctgaggaagcaggaga
ggagtagaaaggaaagattccgggttacctattttaattctagcctagacttactacata

 1.18 Intr +  25369  25551  183  1  0   72   66    69 0.661   1.08
tggcttgtcatgttgatgttctttctaatattatttgtttctcagtaaattaaatagtta
gagataggtgtggactgagggaagacaggaggataagggggtatttgcaccctgagaatt
tgtgatgtccattttgattcatgacttggcaataactcaggtatttttgttcttcaccag
CAACACATTACATTTGGTCTCTACCACCAAAACGGAGGTGATCCCACCTCTCATTGAGAA
CAGGCAGTCCTGGTCAGTTTGCAAGCAAGTCTTTCCTGGCCTGAATTACTGCACCTCAGG
CGCTTACTCCAACGCCAGCTCCACAGACTCCGCCTCCTACTATCCGCTGACCGGGGACAC
CAG
gttagagatgctcagtgcctgacccagcattttctcaccttccacatcatggccacctag
catggcacaggaaaaaatactctgtgttgtaagaccctgtcactagccttctgggtttgc
accatctttgggtatttaaagcagggtcctctggccaacacattgggtgtcaccttttgc

 1.19 Intr +  26161  26282  122  1  2   53  113   156 0.990  13.82
ccttgccttgggttcttgtaggactgagggatcaaaaagatcatcttagttaagggcaag
agacaatgttaaaataaggaccatatttttgttgcatttgaggctgaattgttttgggaa
cataatcaccatccttgaaagctctaacattatgcactgtcttcattgtaatgtctttag
ATTAGAGCTGGAACTGAGGCCTACAGGAGAGATTGAGCAGTATTCTGTCAGCGCAACCTA
TGAGCTCCAGAGAGAGGACAGAGCCTTGGTGGATACCCTGAAGTTTGTAACTCAAGCAGA
AG
gtgagtattcaaaacacagctgcctcatctctgctcgcagtctcaggttcagaattcatg
aggagaagacatgtaatttaacctatttaacaaataggttaactgagtacccactaagcg
gcaggcctattctaagacctgggttaactgagtacccaataagcggcaggcctattctaa

 1.20 Intr +  28625  28835  211  0  1   69   98   238 0.999  19.95
tgtatttttagtagagacggggtttcaccatgttagccagaatggtcttgatctcctgac
ctcatgatctgcccgccttggcctcccaaagtgctgggattacaggtgtgagccaccgca
cccggcccaaaacatagcttcttaccacacatctcttgattctcttatacactcgtccag
GTGCGAAGCAGACTGAGGCTACCATGACATTCAAATATAATCGGCAGAGTATGACCTTGT
CCAGTGAAGTCCAAATTCCGGATTTTGATGTTGACCTCGGAACAATCCTCAGAGTTAATG
ATGAATCTACTGAGGGCAAAACGTCTTACAGACTCACCCTGGACATTCAGAACAAGAAAA
TTACTGAGGTCGCCCTCATGGGCCACCTAAG
gtaaagaaggccgagggtcatctgacctgcactgcaggcctgggtggttcttttcattat
tcctcttccacttcatacctgaccaagccatgttctcccctagtctacaatcagagtggc
agagagagccctcaacaattttttttttttttgagatggagtctcactctgtcaccaggc

 1.21 Intr +  29729  29904  176  2  2   61   80    86 0.988   3.76
caaagtccttaatttgtgctgaatgttggctttagaagttgatgagtttgatctgtggct
gtttctctgaaccatccttgtatctggttttgatcaccacaaatggaacttctgtttaat
cctgcatatctccattgaaaggacaaaatcattggtgccaactgattttctttaccatag
TTGTGACACAAAGGAAGAAAGAAAAATCAAGGGTGTTATTTCCATACCCCGTTTGCAAGC
AGAAGCCAGAAGTGAGATCCTCGCCCACTGGTCGCCTGCCAAACTGCTTCTCCAAATGGA
CTCATCTGCTACAGCTTATGGCTCCACAGTTTCCAAGAGGGTGGCATGGCATTATG
gtatgtgtctcttcccctgtgtgagcacttccaaagtaatgcaggtgttgagacctgtgg
ttacaggctgaactagtaccattcacaactatttcctacgtattttcagatgaagagaag
attgaatttgaatggaacacaggcaccaatgtagataccaaaaaaatgacttccaatttc

 1.22 Intr +  30014  30201  188  0  2   69   81   112 0.923   7.09
gcttctccaaatggactcatctgctacagcttatggctccacagtttccaagagggtggc
atggcattatggtatgtgtctcttcccctgtgtgagcacttccaaagtaatgcaggtgtt
gagacctgtggttacaggctgaactagtaccattcacaactatttcctacgtattttcag
ATGAAGAGAAGATTGAATTTGAATGGAACACAGGCACCAATGTAGATACCAAAAAAATGA
CTTCCAATTTCCCTGTGGATCTCTCCGATTATCCTAAGAGCTTGCATATGTATGCTAATA
GACTCCTGGATCACAGAGTCCCTCAAACAGACATGACTTTCCGGCACGTGGGTTCCAAAT
TAATAGTT
gtaagtatgagtctgccagtcaataaatacatggatataagtgctaattacatcctcaac
tctgagctaggtgcaggaaggtttccaaagatgtataaggcatgcttccttccccccagg
gaattcttggggagaaaaaaaaactttcacaagtgtgtagttacccagttacacaaagct

 1.23 Intr +  30681  30826  146  2  2   91   93    54 0.993   4.36
tatggacagtgatcagtgactggcaacgaagattcataattttctgttatttatttttaa
ctttcagtgcattgtccagcttaataattaacttgtcaaatcggtatttttgcctaatgt
tcattgctctttgaggctcatccaagcccattaccttaaaaatctcctgtcattttgtag
GCAATGAGCTCATGGCTTCAGAAGGCATCTGGGAGTCTTCCTTATACCCAGACTTTGCAA
GACCACCTCAATAGCCTGAAGGAGTTCAACCTCCAGAACATGGGATTGCCAGACTTCCAC
ATCCCAGAAAACCTCTTCTTAAAAAG
gtaaaagaagaaagcagcaaggcttcttgaaccatgcaaagtaaatgaaagattttacat
agcatgatttagacatttttttaaatttttaaaggaaataatttaagcattttaaggaga
ttaataactatagcacaaacactgtggcatctttgcattagtaaacatgagaacaccaac

 1.24 Intr +  31741  32114  374  1  2   89  105   239 0.867  19.48
ttgagtgtttgacaggtggaggtaaaagcaaaggggtccaggcataggagtagcacaaag
aaaagtgcagagtggctttgggaatggggcaagtacaatattgttgtgaaggtcagaggc
agagaactttgaatgactgatgtctgactgtggggatgttatctttgttgttcatttcag
CGATGGCCGGGTCAAATATACCTTGAACAAGAACAGTTTGAAAATTGAGATTCCTTTGCC
TTTTGGTGGCAAATCCTCCAGAGATCTAAAGATGTTAGAGACTGTTAGGACACCAGCCCT
CCACTTCAAGTCTGTGGGATTCCATCTGCCATCTCGAGAGTTCCAAGTCCCTACTTTTAC
CATTCCCAAGTTGTATCAACTGCAAGTGCCTCTCCTGGGTGTTCTAGACCTCTCCACGAA
TGTCTACAGCAACTTGTACAACTGGTCCGCCTCCTACAGTGGTGGCAACACCAGCACAGA
CCATTTCAGCCTTCGGGCTCGTTACCACATGAAGGCTGACTCTGTGGTTGACCTGCTTTC
CTACAATGTGCAAG
gtgagctatgctcaggtaaagggtgcaccgggctagttcatggcaggctctaagaggaga
gcctcctccagggaggaaaggactttggctttctagcagataatcttccttgctacttgg
aagtcttttattttattcaacaaatagaaatatttattaaacatatcacgtgtattaaat

 1.25 Intr +  32623  40194 7572  2  0   77   95  4909 0.997 476.97
caaggcttcctggaggaatgccttttgctatcagattttatctttgcattacagatggag
gagtctattgcacaattggcccagaaaaatggggctttattattgaaagactttcaacat
agagattgctctggaaatgtactgcttaatttaaccaatgtcttttcatttttatgttag
GATCTGGAGAAACAACATATGACCACAAGAATACGTTCACACTATCATATGATGGGTCTC
TACGCCACAAATTTCTAGATTCGAATATCAAATTCAGTCATGTAGAAAAACTTGGAAACA
ACCCAGTCTCAAAAGGTTTACTAATATTCGATGCATCTAGTTCCTGGGGACCACAGATGT
CTGCTTCAGTTCATTTGGACTCCAAAAAGAAACAGCATTTGTTTGTCAAAGAAGTCAAGA
TTGATGGGCAGTTCAGAGTCTCTTCGTTCTATGCTAAAGGCACATATGGCCTGTCTTGTC
AGAGGGATCCTAACACTGGCCGGCTCAATGGAGAGTCCAACCTGAGGTTTAACTCCTCCT
ACCTCCAAGGCACCAACCAGATAACAGGAAGATATGAAGATGGAACCCTCTCCCTCACCT
CCACCTCTGATCTGCAAAGTGGCATCATTAAAAATACTGCTTCCCTAAAGTATGAGAACT
ACGAGCTGACTTTAAAATCTGACACCAATGGGAAGTATAAGAACTTTGCCACTTCTAACA
AGATGGATATGACCTTCTCTAAGCAAAATGCACTGCTGCGTTCTGAATATCAGGCTGATT
ACGAGTCATTGAGGTTCTTCAGCCTGCTTTCTGGATCACTAAATTCCCATGGTCTTGAGT
TAAATGCTGACATCTTAGGCACTGACAAAATTAATAGTGGTGCTCACAAGGCGACACTAA
GGATTGGCCAAGATGGAATATCTACCAGTGCAACGACCAACTTGAAGTGTAGTCTCCTGG
TGCTGGAGAATGAGCTGAATGCAGAGCTTGGCCTCTCTGGGGCATCTATGAAATTAACAA
CAAATGGCCGCTTCAGGGAACACAATGCAAAATTCAGTCTGGATGGGAAAGCCGCCCTCA
CAGAGCTATCACTGGGAAGTGCTTATCAGGCCATGATTCTGGGTGTCGACAGCAAAAACA
TTTTCAACTTCAAGGTCAGTCAAGAAGGACTTAAGCTCTCAAATGACATGATGGGCTCAT
ATGCTGAAATGAAATTTGACCACACAAACAGTCTGAACATTGCAGGCTTATCACTGGACT
TCTCTTCAAAACTTGACAACATTTACAGCTCTGACAAGTTTTATAAGCAAACTGTTAATT
TACAGCTACAGCCCTATTCTCTGGTAACTACTTTAAACAGTGACCTGAAATACAATGCTC
TGGATCTCACCAACAATGGGAAACTACGGCTAGAACCCCTGAAGCTGCATGTGGCTGGTA
ACCTAAAAGGAGCCTACCAAAATAATGAAATAAAACACATCTATGCCATCTCTTCTGCTG
CCTTATCAGCAAGCTATAAAGCAGACACTGTTGCTAAGGTTCAGGGTGTGGAGTTTAGCC
ATCGGCTCAACACAGACATCGCTGGGCTGGCTTCAGCCATTGACATGAGCACAAACTATA
ATTCAGACTCACTGCATTTCAGCAATGTCTTCCGTTCTGTAATGGCCCCGTTTACCATGA
CCATCGATGCACATACAAATGGCAATGGGAAACTCGCTCTCTGGGGAGAACATACTGGGC
AGCTGTATAGCAAATTCCTGTTGAAAGCAGAACCTCTGGCATTTACTTTCTCTCATGATT
ACAAAGGCTCCACAAGTCATCATCTCGTGTCTAGGAAAAGCATCAGTGCAGCTCTTGAAC
ACAAAGTCAGTGCCCTGCTTACTCCAGCTGAGCAGACAGGCACCTGGAAACTCAAGACCC
AATTTAACAACAATGAATACAGCCAGGACTTGGATGCTTACAACACTAAAGATAAAATTG
GCGTGGAGCTTACTGGACGAACTCTGGCTGACCTAACTCTACTAGACTCCCCAATTAAAG
TGCCACTTTTACTCAGTGAGCCCATCAATATCATTGATGCTTTAGAGATGAGAGATGCCG
TTGAGAAGCCCCAAGAATTTACAATTGTTGCTTTTGTAAAGTATGATAAAAACCAAGATG
TTCACTCCATTAACCTCCCATTTTTTGAGACCTTGCAAGAATATTTTGAGAGGAATCGAC
AAACCATTATAGTTGTACTGGAAAACGTACAGAGAAACCTGAAGCACATCAATATTGATC
AATTTGTAAGAAAATACAGAGCAGCCCTGGGAAAACTCCCACAGCAAGCTAATGATTATC
TGAATTCATTCAATTGGGAGAGACAAGTTTCACATGCCAAGGAGAAACTGACTGCTCTCA
CAAAAAAGTATAGAATTACAGAAAATGATATACAAATTGCATTAGATGATGCCAAAATCA
ACTTTAATGAAAAACTATCTCAACTGCAGACATATATGATACAATTTGATCAGTATATTA
AAGATAGTTATGATTTACATGATTTGAAAATAGCTATTGCTAATATTATTGATGAAATCA
TTGAAAAATTAAAAAGTCTTGATGAGCACTATCATATCCGTGTAAATTTAGTAAAAACAA
TCCATGATCTACATTTGTTTATTGAAAATATTGATTTTAACAAAAGTGGAAGTAGTACTG
CATCCTGGATTCAAAATGTGGATACTAAGTACCAAATCAGAATCCAGATACAAGAAAAAC
TGCAGCAGCTTAAGAGACACATACAGAATATAGACATCCAGCACCTAGCTGGAAAGTTAA
AACAACACATTGAGGCTATTGATGTTAGAGTGCTTTTAGATCAATTGGGAACTACAATTT
CATTTGAAAGAATAAATGACATTCTTGAGCATGTCAAACACTTTGTTATAAATCTTATTG
GGGATTTTGAAGTAGCTGAGAAAATCAATGCCTTCAGAGCCAAAGTCCATGAGTTAATCG
AGAGGTATGAAGTAGACCAACAAATCCAGGTTTTAATGGATAAATTAGTAGAGTTGGCCC
ACCAATACAAGTTGAAGGAGACTATTCAGAAGCTAAGCAATGTCCTACAACAAGTTAAGA
TAAAAGATTACTTTGAGAAATTGGTTGGATTTATTGATGATGCTGTCAAGAAGCTTAATG
AATTATCTTTTAAAACATTCATTGAAGATGTTAACAAATTCCTTGACATGTTGATAAAGA
AATTAAAGTCATTTGATTACCACCAGTTTGTAGATGAAACCAATGACAAAATCCGTGAGG
TGACTCAGAGACTCAATGGTGAAATTCAGGCTCTGGAACTACCACAAAAAGCTGAAGCAT
TAAAACTGTTTTTAGAGGAAACCAAGGCCACAGTTGCAGTGTATCTGGAAAGCCTACAGG
ACACCAAAATAACCTTAATCATCAATTGGTTACAGGAGGCTTTAAGTTCAGCATCTTTGG
CTCACATGAAGGCCAAATTCCGAGAGACCCTAGAAGATACACGAGACCGAATGTATCAAA
TGGACATTCAGCAGGAACTTCAACGATACCTGTCTCTGGTAGGCCAGGTTTATAGCACAC
TTGTCACCTACATTTCTGATTGGTGGACTCTTGCTGCTAAGAACCTTACTGACTTTGCAG
AGCAATATTCTATCCAAGATTGGGCTAAACGTATGAAAGCATTGGTAGAGCAAGGGTTCA
CTGTTCCTGAAATCAAGACCATCCTTGGGACCATGCCTGCCTTTGAAGTCAGTCTTCAGG
CTCTTCAGAAAGCTACCTTCCAGACACCTGATTTTATAGTCCCCCTAACAGATTTGAGGA
TTCCATCAGTTCAGATAAACTTCAAAGACTTAAAAAATATAAAAATCCCATCCAGGTTTT
CCACACCAGAATTTACCATCCTTAACACCTTCCACATTCCTTCCTTTACAATTGACTTTG
TAGAAATGAAAGTAAAGATCATCAGAACCATTGACCAGATGCTGAACAGTGAGCTGCAGT
GGCCCGTTCCAGATATATATCTCAGGGATCTGAAGGTGGAGGACATTCCTCTAGCGAGAA
TCACCCTGCCAGACTTCCGTTTACCAGAAATCGCAATTCCAGAATTCATAATCCCAACTC
TCAACCTTAATGATTTTCAAGTTCCTGACCTTCACATACCAGAATTCCAGCTTCCCCACA
TCTCACACACAATTGAAGTACCTACTTTTGGCAAGCTATACAGTATTCTGAAAATCCAAT
CTCCTCTTTTCACATTAGATGCAAATGCTGACATAGGGAATGGAACCACCTCAGCAAACG
AAGCAGGTATCGCAGCTTCCATCACTGCCAAAGGAGAGTCCAAATTAGAAGTTCTCAATT
TTGATTTTCAAGCAAATGCACAACTCTCAAACCCTAAGATTAATCCGCTGGCTCTGAAGG
AGTCAGTGAAGTTCTCCAGCAAGTACCTGAGAACGGAGCATGGGAGTGAAATGCTGTTTT
TTGGAAATGCTATTGAGGGAAAATCAAACACAGTGGCAAGTTTACACACAGAAAAAAATA
CACTGGAGCTTAGTAATGGAGTGATTGTCAAGATAAACAATCAGCTTACCCTGGATAGCA
ACACTAAATACTTCCACAAATTGAACATCCCCAAACTGGACTTCTCTAGTCAGGCTGACC
TGCGCAACGAGATCAAGACACTGTTGAAAGCTGGCCACATAGCATGGACTTCTTCTGGAA
AAGGGTCATGGAAATGGGCCTGCCCCAGATTCTCAGATGAGGGAACACATGAATCACAAA
TTAGTTTCACCATAGAAGGACCCCTCACTTCCTTTGGACTGTCCAATAAGATCAATAGCA
AACACCTAAGAGTAAACCAAAACTTGGTTTATGAATCTGGCTCCCTCAACTTTTCTAAAC
TTGAAATTCAATCACAAGTCGATTCCCAGCATGTGGGCCACAGTGTTCTAACTGCTAAAG
GCATGGCACTGTTTGGAGAAGGGAAGGCAGAGTTTACTGGGAGGCATGATGCTCATTTAA
ATGGAAAGGTTATTGGAACTTTGAAAAATTCTCTTTTCTTTTCAGCCCAGCCATTTGAGA
TCACGGCATCCACAAACAATGAAGGGAATTTGAAAGTTCGTTTTCCATTAAGGTTAACAG
GGAAGATAGACTTCCTGAATAACTATGCACTGTTTCTGAGTCCCAGTGCCCAGCAAGCAA
GTTGGCAAGTAAGTGCTAGGTTCAATCAGTATAAGTACAACCAAAATTTCTCTGCTGGAA
ACAACGAGAACATTATGGAGGCCCATGTAGGAATAAATGGAGAAGCAAATCTGGATTTCT
TAAACATTCCTTTAACAATTCCTGAAATGCGTCTACCTTACACAATAATCACAACTCCTC
CACTGAAAGATTTCTCTCTATGGGAAAAAACAGGCTTGAAGGAATTCTTGAAAACGACAA
AGCAATCATTTGATTTAAGTGTAAAAGCTCAGTATAAGAAAAACAAACACAGGCATTCCA
TCACAAATCCTTTGGCTGTGCTTTGTGAGTTTATCAGTCAGAGCATCAAATCCTTTGACA
GGCATTTTGAAAAAAACAGAAACAATGCATTAGATTTTGTCACCAAATCCTATAATGAAA
CAAAAATTAAGTTTGATAAGTACAAAGCTGAAAAATCTCACGACGAGCTCCCCAGGACCT
TTCAAATTCCTGGATACACTGTTCCAGTTGTCAATGTTGAAGTGTCTCCATTCACCATAG
AGATGTCGGCATTCGGCTATGTGTTCCCAAAAGCAGTCAGCATGCCTAGTTTCTCCATCC
TAGGTTCTGACGTCCGTGTGCCTTCATACACATTAATCCTGCCATCATTAGAGCTGCCAG
TCCTTCATGTCCCTAGAAATCTCAAGCTTTCTCTTCCAGATTTCAAGGAATTGTGTACCA
TAAGCCATATTTTTATTCCTGCCATGGGCAATATTACCTATGATTTCTCCTTTAAATCAA
GTGTCATCACACTGAATACCAATGCTGAACTTTTTAACCAGTCAGATATTGTTGCTCATC
TCCTTTCTTCATCTTCATCTGTCATTGATGCACTGCAGTACAAATTAGAGGGCACCACAA
GATTGACAAGAAAAAGGGGATTGAAGTTAGCCACAGCTCTGTCTCTGAGCAACAAATTTG
TGGAGGGTAGTCATAACAGTACTGTGAGCTTAACCACGAAAAATATGGAAGTGTCAGTGG
CAACAACCACAAAAGCCCAAATTCCAATTTTGAGAATGAATTTCAAGCAAGAACTTAATG
GAAATACCAAGTCAAAACCTACTGTCTCTTCCTCCATGGAATTTAAGTATGATTTCAATT
CTTCAATGCTGTACTCTACCGCTAAAGGAGCAGTTGACCACAAGCTTAGCTTGGAAAGCC
TCACCTCTTACTTTTCCATTGAGTCATCTACCAAAGGAGATGTCAAGGGTTCGGTTCTTT
CTCGGGAATATTCAGGAACTATTGCTAGTGAGGCCAACACTTACTTGAATTCCAAGAGCA
CACGGTCTTCAGTGAAGCTGCAGGGCACTTCCAAAATTGATGATATCTGGAACCTTGAAG
TAAAAGAAAATTTTGCTGGAGAAGCCACACTCCAACGCATATATTCCCTCTGGGAGCACA
GTACGAAAAACCACTTACAGCTAGAGGGCCTCTTTTTCACCAACGGAGAACATACAAGCA
AAGCCACCCTGGAACTCTCTCCATGGCAAATGTCAGCTCTTGTTCAGGTCCATGCAAGTC
AGCCCAGTTCCTTCCATGATTTCCCTGACCTTGGCCAGGAAGTGGCCCTGAATGCTAACA
CTAAGAACCAGAAGATCAGATGGAAAAATGAAGTCCGGATTCATTCTGGGTCTTTCCAGA
GCCAGGTCGAGCTTTCCAATGACCAAGAAAAGGCACACCTTGACATTGCAGGATCCTTAG
AAGGACACCTAAGGTTCCTCAAAAATATCATCCTACCAGTCTATGACAAGAGCTTATGGG
ATTTCCTAAAGCTGGATGTAACCACCAGCATTGGTAGGAGACAGCATCTTCGTGTTTCAA
CTGCCTTTGTGTACACCAAAAACCCCAATGGCTATTCATTCTCCATCCCTGTAAAAGTTT
TGGCTGATAAATTCATTATTCCTGGGCTGAAACTAAATGATCTAAATTCAGTTCTTGTCA
TGCCTACGTTCCATGTCCCATTTACAGATCTTCAGGTTCCATCGTGCAAACTTGACTTCA
GAGAAATACAAATCTATAAGAAGCTGAGAACTTCATCATTTGCCCTCAACCTACCAACAC
TCCCCGAGGTAAAATTCCCTGAAGTTGATGTGTTAACAAAATATTCTCAACCAGAAGACT
CCTTGATTCCCTTTTTTGAGATAACCGTGCCTGAATCTCAGTTAACTGTGTCCCAGTTCA
CGCTTCCAAAAAGTGTTTCAGATGGCATTGCTGCTTTGGATCTAAATGCAGTAGCCAACA
AGATCGCAGACTTTGAGTTGCCCACCATCATCGTGCCTGAGCAGACCATTGAGATTCCCT
CCATTAAGTTCTCTGTACCTGCTGGAATTGTCATTCCTTCCTTTCAAGCACTGACTGCAC
GCTTTGAGGTAGACTCTCCCGTGTATAATGCCACTTGGAGTGCCAGTTTGAAAAACAAAG
CAGATTATGTTGAAACAGTCCTGGATTCCACATGCAGCTCAACCGTACAGTTCCTAGAAT
ATGAACTAAATG
gtaagaaatatcctgcctcctctcctagatactgtatattttcaatgagagttatgagta
aataattatgtatttagttgtgagtagatgtacaattactcaatgtcacaaaattttaag
taagaaaagagatacatgtataccctacacgtaaaaaccaaactgtagaaaatctagtgt

 1.26 Intr +  40599  40713  115  1  1   53    8   101 0.999  -2.81
tattttaggactaacaatgtcttttaactatttattttaaaataagtgtgagctgtacat
tgcatattttaaacacaagtgaaatatctggttaggatagaattctcccagttttcacaa
tgaaaacatcaacgtcctactgttatgaatctaataaaatacaaaatctctcctatacag
TTTTGGGAACACACAAAATCGAAGATGGTACGTTAGCCTCTAAGACTAAAGGAACATTTG
CACACCGTGACTTCAGTGCAGAATATGAAGAAGATGGCAAATATGAAGGACTTCA
gtatggagcttttattgaattgaaaccttataccttttgaaaactcattgtgattttctt
catctccatacccctttcgtgatagctcatctgtttttctgctttcagggaatgggaagg
aaaagcgcacctcaatatcaaaagcccagcgttcaccgatctccatctgcgctaccagaa

 1.27 Intr +  40822  41005  184  1  1  114   99   164 0.999  18.97
gactaaaggaacatttgcacaccgtgacttcagtgcagaatatgaagaagatggcaaata
tgaaggacttcagtatggagcttttattgaattgaaaccttataccttttgaaaactcat
tgtgattttcttcatctccatacccctttcgtgatagctcatctgtttttctgctttcag
GGAATGGGAAGGAAAAGCGCACCTCAATATCAAAAGCCCAGCGTTCACCGATCTCCATCT
GCGCTACCAGAAAGACAAGAAAGGCATCTCCACCTCAGCAGCCTCCCCAGCCGTAGGCAC
CGTGGGCATGGATATGGATGAAGATGACGACTTTTCTAAATGGAACTTCTACTACAGCCC
TCAG
gtaaataccacctaatgagtgacacgcccccaagagcgagtggagaattggggcagatac
atttaattcaggaccaaatattcagagattccccaaactaggtgaaagacaggcggtaag
caacttcttctctgaggaaatattctctagaaagtattacaatgagtccttgattgattt

 1.28 Term +  41940  43544 1605  2  0   82   28   951 0.999  77.59
aacagtagacttatttaaccataaaacaaacacatgaactgacatatgaaagataaatcc
ctttcagtatatgaaagattctctgatctttatttttaactgctaatgaagttttagtgt
actatattgtgtaattggagtaattgaaaacatgttatttttttttttctctctgtttag
TCCTCTCCAGATAAAAAACTCACCATATTCAAAACTGAGTTGAGGGTCCGGGAATCTGAT
GAGGAAACTCAGATCAAAGTTAATTGGGAAGAAGAGGCAGCTTCTGGCTTGCTAACCTCT
CTGAAAGACAACGTGCCCAAGGCCACAGGGGTCCTTTATGATTATGTCAACAAGTACCAC
TGGGAACACACAGGGCTCACCCTGAGAGAAGTGTCTTCAAAGCTGAGAAGAAATCTGCAG
AACAATGCTGAGTGGGTTTATCAAGGGGCCATTAGGCAAATTGATGATATCGACGTGAGG
TTCCAGAAAGCAGCCAGTGGCACCACTGGGACCTACCAAGAGTGGAAGGACAAGGCCCAG
AATCTGTACCAGGAACTGTTGACTCAGGAAGGCCAAGCCAGTTTCCAGGGACTCAAGGAT
AACGTGTTTGATGGCTTGGTACGAGTTACTCAAGAATTCCATATGAAAGTCAAGCATCTG
ATTGACTCACTCATTGATTTTCTGAACTTCCCCAGATTCCAGTTTCCGGGGAAACCTGGG
ATATACACTAGGGAGGAACTTTGCACTATGTTCATAAGGGAGGTAGGGACGGTACTGTCC
CAGGTATATTCGAAAGTCCATAATGGTTCAGAAATACTGTTTTCCTATTTCCAAGACCTA
GTGATTACACTTCCTTTCGAGTTAAGGAAACATAAACTAATAGATGTAATCTCGATGTAT
AGGGAACTGTTGAAAGATTTATCAAAAGAAGCCCAAGAGGTATTTAAAGCCATTCAGTCT
CTCAAGACCACAGAGGTGCTACGTAATCTTCAGGACCTTTTACAATTCATTTTCCAACTA
ATAGAAGATAACATTAAACAGCTGAAAGAGATGAAATTTACTTATCTTATTAATTATATC
CAAGATGAGATCAACACAATCTTCAGTGATTATATCCCATATGTTTTTAAATTGTTGAAA
GAAAACCTATGCCTTAATCTTCATAAGTTCAATGAATTTATTCAAAACGAGCTTCAGGAA
GCTTCTCAAGAGTTACAGCAGATCCATCAATACATTATGGCCCTTCGTGAAGAATATTTT
GATCCAAGTATAGTTGGCTGGACAGTGAAATATTATGAACTTGAAGAAAAGATAGTCAGT
CTGATCAAGAACCTGTTAGTTGCTCTTAAGGACTTCCATTCTGAATATATTGTCAGTGCC
TCTAACTTTACTTCCCAACTCTCAAGTCAAGTTGAGCAATTTCTGCACAGAAATATTCAG
GAATATCTTAGCATCCTTACCGATCCAGATGGAAAAGGGAAAGAGAAGATTGCAGAGCTT
TCTGCCACTGCTCAGGAAATAATTAAAAGCCAGGCCATTGCGACGAAGAAAATAATTTCT
GATTACCACCAGCAGTTTAGATATAAACTGCAAGATTTTTCAGACCAACTCTCTGATTAC
TATGAAAAATTTATTGCTGAATCCAAAAGATTGATTGACCTGTCCATTCAAAACTACCAC
ACATTTCTGATATACATCACGGAGTTACTGAAAAAGCTGCAATCAACCACAGTCATGAAC
CCCTACATGAAGCTTGCTCCAGGAGAACTTACTATCATCCTCTAA
ttttttaaaagaaatcttcatttattcttcttttccaattgaactttcacatagcacaga
aaaaattcaaactgcctatattgataaaaccatacagtgagccagccttgcagtaggcag
tagactataagcagaagcacatatgaactggacctgcaccaaagctggcaccagggctcg

Predicted peptide sequence(s):


>APOB_1|GENSCAN_predicted_peptide_1|4590_aa
MDPPRPALLALLALPALLLLLLAGARAGECAAALRAQREREGAGGTRIGCPWESYFCYVA
DVFLPTLEDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILK
TSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYI
LNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVATEISTERDLGQCD
RFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYK
NKYGMVAQVTQTLKLEDTPKINSRFFGEGTKKMGLAFESTKSTSPPKQAEAVLKTLQELK
KLTISEQNIQRANLFNKLVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTH
ILQWLKRVHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYH
KTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTMEQLTPELKSSILKC
VQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLDDASPGDKRLAAYLMLMRSPSQAD
INKIVQILPWEQNEQVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKF
SRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLE
GKGFEPTLEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNG
IMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLLMGARTLQGIPQMI
GEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISSSGVIAPGAKAGVKLEVANMQAEL
VAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEAHVALKAGKLKFIIPSPKRPV
KLLSGGNTLHLVSTTKTEVIPPLIENRQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYY
PLTGDTRLELELRPTGEIEQYSVSATYELQREDRALVDTLKFVTQAEGAKQTEATMTFKY
NRQSMTLSSEVQIPDFDVDLGTILRVNDESTEGKTSYRLTLDIQNKKITEVALMGHLSCD
TKEERKIKGVISIPRLQAEARSEILAHWSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEK
IEFEWNTGTNVDTKKMTSNFPVDLSDYPKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVA
MSSWLQKASGSLPYTQTLQDHLNSLKEFNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNS
LKIEIPLPFGGKSSRDLKMLETVRTPALHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLL
GVLDLSTNVYSNLYNWSASYSGGNTSTDHFSLRARYHMKADSVVDLLSYNVQGSGETTYD
HKNTFTLSYDGSLRHKFLDSNIKFSHVEKLGNNPVSKGLLIFDASSSWGPQMSASVHLDS
KKKQHLFVKEVKIDGQFRVSSFYAKGTYGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQI
TGRYEDGTLSLTSTSDLQSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSK
QNALLRSEYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQDGIS
TSATTNLKCSLLVLENELNAELGLSGASMKLTTNGRFREHNAKFSLDGKAALTELSLGSA
YQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNI
YSSDKFYKQTVNLQLQPYSLVTTLNSDLKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQN
NEIKHIYAISSAALSASYKADTVAKVQGVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFS
NVFRSVMAPFTMTIDAHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHH
LVSRKSISAALEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRT
LADLTLLDSPIKVPLLLSEPINIIDALEMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPF
FETLQEYFERNRQTIIVVLENVQRNLKHINIDQFVRKYRAALGKLPQQANDYLNSFNWER
QVSHAKEKLTALTKKYRITENDIQIALDDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHD
LKIAIANIIDEIIEKLKSLDEHYHIRVNLVKTIHDLHLFIENIDFNKSGSSTASWIQNVD
TKYQIRIQIQEKLQQLKRHIQNIDIQHLAGKLKQHIEAIDVRVLLDQLGTTISFERINDI
LEHVKHFVINLIGDFEVAEKINAFRAKVHELIERYEVDQQIQVLMDKLVELAHQYKLKET
IQKLSNVLQQVKIKDYFEKLVGFIDDAVKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYH
QFVDETNDKIREVTQRLNGEIQALELPQKAEALKLFLEETKATVAVYLESLQDTKITLII
NWLQEALSSASLAHMKAKFRETLEDTRDRMYQMDIQQELQRYLSLVGQVYSTLVTYISDW
WTLAAKNLTDFAEQYSIQDWAKRMKALVEQGFTVPEIKTILGTMPAFEVSLQALQKATFQ
TPDFIVPLTDLRIPSVQINFKDLKNIKIPSRFSTPEFTILNTFHIPSFTIDFVEMKVKII
RTIDQMLNSELQWPVPDIYLRDLKVEDIPLARITLPDFRLPEIAIPEFIIPTLNLNDFQV
PDLHIPEFQLPHISHTIEVPTFGKLYSILKIQSPLFTLDANADIGNGTTSANEAGIAASI
TAKGESKLEVLNFDFQANAQLSNPKINPLALKESVKFSSKYLRTEHGSEMLFFGNAIEGK
SNTVASLHTEKNTLELSNGVIVKINNQLTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTL
LKAGHIAWTSSGKGSWKWACPRFSDEGTHESQISFTIEGPLTSFGLSNKINSKHLRVNQN
LVYESGSLNFSKLEIQSQVDSQHVGHSVLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTL
KNSLFFSAQPFEITASTNNEGNLKVRFPLRLTGKIDFLNNYALFLSPSAQQASWQVSARF
NQYKYNQNFSAGNNENIMEAHVGINGEANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLW
EKTGLKEFLKTTKQSFDLSVKAQYKKNKHRHSITNPLAVLCEFISQSIKSFDRHFEKNRN
NALDFVTKSYNETKIKFDKYKAEKSHDELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYV
FPKAVSMPSFSILGSDVRVPSYTLILPSLELPVLHVPRNLKLSLPDFKELCTISHIFIPA
MGNITYDFSFKSSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGL
KLATALSLSNKFVEGSHNSTVSLTTKNMEVSVATTTKAQIPILRMNFKQELNGNTKSKPT
VSSSMEFKYDFNSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDVKGSVLSREYSGTI
ASEANTYLNSKSTRSSVKLQGTSKIDDIWNLEVKENFAGEATLQRIYSLWEHSTKNHLQL
EGLFFTNGEHTSKATLELSPWQMSALVQVHASQPSSFHDFPDLGQEVALNANTKNQKIRW
KNEVRIHSGSFQSQVELSNDQEKAHLDIAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVT
TSIGRRQHLRVSTAFVYTKNPNGYSFSIPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPF
TDLQVPSCKLDFREIQIYKKLRTSSFALNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEI
TVPESQLTVSQFTLPKSVSDGIAALDLNAVANKIADFELPTIIVPEQTIEIPSIKFSVPA
GIVIPSFQALTARFEVDSPVYNATWSASLKNKADYVETVLDSTCSSTVQFLEYELNVLGT
HKIEDGTLASKTKGTFAHRDFSAEYEEDGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKD
KKGISTSAASPAVGTVGMDMDEDDDFSKWNFYYSPQSSPDKKLTIFKTELRVRESDEETQ
IKVNWEEEAASGLLTSLKDNVPKATGVLYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAE
WVYQGAIRQIDDIDVRFQKAASGTTGTYQEWKDKAQNLYQELLTQEGQASFQGLKDNVFD
GLVRVTQEFHMKVKHLIDSLIDFLNFPRFQFPGKPGIYTREELCTMFIREVGTVLSQVYS
KVHNGSEILFSYFQDLVITLPFELRKHKLIDVISMYRELLKDLSKEAQEVFKAIQSLKTT
EVLRNLQDLLQFIFQLIEDNIKQLKEMKFTYLINYIQDEINTIFSDYIPYVFKLLKENLC
LNLHKFNEFIQNELQEASQELQQIHQYIMALREEYFDPSIVGWTVKYYELEEKIVSLIKN
LLVALKDFHSEYIVSASNFTSQLSSQVEQFLHRNIQEYLSILTDPDGKGKEKIAELSATA
QEIIKSQAIATKKIISDYHQQFRYKLQDFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLI
YITELLKKLQSTTVMNPYMKLAPGELTIIL