GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:48:55

Sequence ALPP_1 : 6532 bp : 60.06% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1254   1329   76  2  1   81   95   247 0.721  24.04
accctgccactcccttcagccagtgtggcttcaggtcaagaggctgggcagggtcaaggt
ggcaacgaggggagaagccgggacacagttctccctgatttaaacccgggcagcctggag
tgcagctcatactccatgcccagaattcctgcctcgccactgtcctgctgccctccagac
ATGCTGGGGCCCTGCATGCTGCTGCTGCTGCTGCTGCTGGGCCTGAGGCTACAGCTCTCC
CTGGGCATCATCCCAG
gtaatgaggctccccgagctgcccctacacaacacacacacagggcaccccccagcccag
gctgacctgatttttgctctccccctggccagttgaggaggagaacccggacttctggaa
ccgcgaggcagccgaggccctgggtgccgccaagaagctgcagcctgcacagacagccgc

 1.02 Intr +   1422   1538  117  1  0   94  101   247 0.999  28.21
tgccctccagacatgctggggccctgcatgctgctgctgctgctgctgctgggcctgagg
ctacagctctccctgggcatcatcccaggtaatgaggctccccgagctgcccctacacaa
cacacacacagggcaccccccagcccaggctgacctgatttttgctctccccctggccag
TTGAGGAGGAGAACCCGGACTTCTGGAACCGCGAGGCAGCCGAGGCCCTGGGTGCCGCCA
AGAAGCTGCAGCCTGCACAGACAGCCGCCAAGAACCTCATCATCTTCCTGGGCGATG
gtgagtgagccaggccttccagccctgcagccctcacagccccggcgcccggaccctcag
tggttccaggagagccctggggcccaagcctcacacatttctgttccttcagggatgggg
gtgtctacggtgacagctgccaggatcctaaaagggcagaagaaggacaaactggggcct

 1.03 Intr +   1651   1766  116  2  2   95  115   108 0.999  15.54
gggtgccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttcct
gggcgatggtgagtgagccaggccttccagccctgcagccctcacagccccggcgcccgg
accctcagtggttccaggagagccctggggcccaagcctcacacatttctgttccttcag
GGATGGGGGTGTCTACGGTGACAGCTGCCAGGATCCTAAAAGGGCAGAAGAAGGACAAAC
TGGGGCCTGAGATACCCCTGGCCATGGACCGCTTCCCATATGTGGCTCTGTCCAAG
gtaagtgctgggctaccttagagtcctccaagcacagaaggggaatcctggctatggagt
gtggtaggagggagggaccctaaacagctggggctccagtaaggagttagaggcagttgg
aatcccagaggacagagatcagggtctgggtctccgtgtctgccccagagaagagctcag

 1.04 Intr +   1964   2138  175  1  1   33   99   262 0.962  22.51
ttagagtcctccaagcacagaaggggaatcctggctatggagtgtggtaggagggaggga
ccctaaacagctggggctccagtaaggagttagaggcagttggaatcccagaggacagag
atcagggtctgggtctccgtgtctgccccagagaagagctcagagtgtctctgtccccag
ACATACAATGTAGACAAACATGTGCCAGACAGTGGAGCCACAGCCACGGCCTACCTGTGC
GGGGTCAAGGGCAACTTCCAGACCATTGGCTTGAGTGCAGCCGCCCGCTTTAACCAGTGC
AACACGACACGCGGCAACGAGGTCATCTCCGTGATGAATCGGGCCAAGAAAGCAG
gtgagctggggcccgctgctgggtcacggccaggtcacagacgttggtcacatatactga
cctctgacacccttagggaagtcagtgggagtggtaaccaccacacgagtgcagcacgcc
tcgccagccggcacctacgcccacacggtgaaccgcaactggtactcggacgccgacgtg

 1.05 Intr +   2215   2387  173  2  2   63   11   273 0.997  17.96
caacttccagaccattggcttgagtgcagccgcccgctttaaccagtgcaacacgacacg
cggcaacgaggtcatctccgtgatgaatcgggccaagaaagcaggtgagctggggcccgc
tgctgggtcacggccaggtcacagacgttggtcacatatactgacctctgacacccttag
GGAAGTCAGTGGGAGTGGTAACCACCACACGAGTGCAGCACGCCTCGCCAGCCGGCACCT
ACGCCCACACGGTGAACCGCAACTGGTACTCGGACGCCGACGTGCCTGCCTCCGCCCGCC
AGGAGGGGTGCCAGGACATCGCTACGCAGCTCATCTCCAACATGGACATTGAC
gtgcgacccccaggccaagggctggggctgggcagagagtagcagggagggggcactagc
tcagacccaggcaaccaaaagccttatctgggccagcagggtctggaggtggggttgtgg
gcgtagaaggtgcagcccaggctgggccattcccacagccttggggaggggagtcagggg

 1.06 Intr +   2637   2771  135  2  0  118   64   146 0.997  17.15
ggcaaccaaaagccttatctgggccagcagggtctggaggtggggttgtgggcgtagaag
gtgcagcccaggctgggccattcccacagccttggggaggggagtcaggggctgtgcatg
aggagggggcacggggccagccagggccccaaatccacctgccccatcctctgttcccag
GTGATCCTAGGTGGAGGCCGAAAGTACATGTTTCGCATGGGAACCCCAGACCCTGAGTAC
CCAGATGACTACAGCCAAGGTGGGACCAGGCTGGACGGGAAGAATCTGGTGCAGGAATGG
CTGGCGAAGCGCCAG
gtgatgggggctggcgggtgcagggggcacagcagggggagggcagaggtgtggggctca
gggctgtgggctgaggcctggctctctccctccccacagggtgcccggtatgtgtggaac
cgcactgagctcatgcaggcttccctggacccgtctgtgacccatctcatgggtaatgac

 1.07 Intr +   2871   2943   73  2  1  126   30    67 0.999   4.83
gagtacccagatgactacagccaaggtgggaccaggctggacgggaagaatctggtgcag
gaatggctggcgaagcgccaggtgatgggggctggcgggtgcagggggcacagcaggggg
agggcagaggtgtggggctcagggctgtgggctgaggcctggctctctccctccccacag
GGTGCCCGGTATGTGTGGAACCGCACTGAGCTCATGCAGGCTTCCCTGGACCCGTCTGTG
ACCCATCTCATGG
gtaatgacccccttcctgccctggcatccctcagatggcctcagatggcaccttctgagc
ctgtgtgcacatccgccagcacccgcccacccccagcctgccagtcaccacaggacccct
tgtcccacaggtctctttgagcctggagacatgaaatacgagatccaccgagactccaca

 1.08 Intr +   3074   3208  135  0  0  125   69   200 0.999  23.52
cactgagctcatgcaggcttccctggacccgtctgtgacccatctcatgggtaatgaccc
ccttcctgccctggcatccctcagatggcctcagatggcaccttctgagcctgtgtgcac
atccgccagcacccgcccacccccagcctgccagtcaccacaggaccccttgtcccacag
GTCTCTTTGAGCCTGGAGACATGAAATACGAGATCCACCGAGACTCCACACTGGACCCCT
CCCTGATGGAGATGACAGAGGCTGCCCTGCGCCTGCTGAGCAGGAACCCCCGCGGCTTCT
TCCTCTTCGTGGAGG
gtgcgtggtggcccctggggagtgggggttgggggttggagcagggcaggctcagcatct
cccccctctggccttcctgcaggtggtcgcatcgaccatggtcatcatgaaagcagggct
taccgggcactgactgagacgatcatgttcgacgacgccattgagagggcgggccagctc

 1.09 Intr +   3291   3482  192  1  0  109   74   345 0.999  35.87
ccgagactccacactggacccctccctgatggagatgacagaggctgccctgcgcctgct
gagcaggaacccccgcggcttcttcctcttcgtggagggtgcgtggtggcccctggggag
tgggggttgggggttggagcagggcaggctcagcatctcccccctctggccttcctgcag
GTGGTCGCATCGACCATGGTCATCATGAAAGCAGGGCTTACCGGGCACTGACTGAGACGA
TCATGTTCGACGACGCCATTGAGAGGGCGGGCCAGCTCACCAGCGAGGAGGACACGCTGA
GCCTCGTCACTGCCGACCACTCCCACGTCTTCTCCTTCGGAGGCTACCCCCTGCGAGGGA
GCTCCATCTTCG
gtaggcctggggagagtggcaggtgctgctgcagcaattaagtgggtgaaatctgagcct
cagtctcctcctctgtcaaatgggagtaatgctggcaccagccctgtagggtctcctgag
gactaagcccctgaccaggcaaaacgtggcggtgcctagcacgtgggagacactccacag

 1.10 Intr +   3702   3818  117  1  0  118  101   186 0.999  24.51
aagtgggtgaaatctgagcctcagtctcctcctctgtcaaatgggagtaatgctggcacc
agccctgtagggtctcctgaggactaagcccctgaccaggcaaaacgtggcggtgcctag
cacgtgggagacactccacagctgtgttcagctcaaccacagggacccctctctctgcag
GGCTGGCCCCTGGCAAGGCCCGGGACAGGAAGGCCTACACGGTCCTCCTATACGGAAACG
GTCCAGGCTATGTGCTCAAGGACGGCGCCCGGCCGGATGTTACCGAGAGCGAGAGCG
gtgagtgccgcggggtggccccctgagggggaccagggtgccaaggatggggggctggcg
ggaaggggtcacctcctgtctgcctggaactgaatgaaccctcctaccggaactgaaccc
tccaaccagggagccccgagtatcggcagcagtcagcagtgcccctggacgaagagaccc

 1.11 Term +   3948   4246  299  1  2   28   48   599 0.999  46.35
gctatgtgctcaaggacggcgcccggccggatgttaccgagagcgagagcggtgagtgcc
gcggggtggccccctgagggggaccagggtgccaaggatggggggctggcgggaaggggt
cacctcctgtctgcctggaactgaatgaaccctcctaccggaactgaaccctccaaccag
GGAGCCCCGAGTATCGGCAGCAGTCAGCAGTGCCCCTGGACGAAGAGACCCACGCAGGCG
AGGACGTGGCGGTGTTCGCGCGCGGCCCGCAGGCGCACCTGGTTCACGGCGTGCAGGAGC
AGACCTTCATAGCGCACGTCATGGCCTTCGCCGCCTGCCTGGAGCCCTACACCGCCTGCG
ACCTGGCGCCCCCCGCCGGCACCACCGACGCCGCGCACCCGGGGCGGTCCGTGGTCCCCG
CGTTGCTTCCTCTGCTGGCCGGGACCCTGCTGCTGCTGGAGACGGCCACTGCTCCCTGA
gtgtcccgtccctggggctcctgcttccccatcccggagttctcctgctccccacctcct
gtcgtcctgcctggcctccagcccgagtcgtcatccccggagtccctatacagaggtcct
gccatggaaccttcccctccccgtgcgctctggggactgagcccatgacaccaaacctgc

Predicted peptide sequence(s):


>ALPP_1|GENSCAN_predicted_peptide_1|535_aa
MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAEALGAAKKLQPAQTAAKNLII
FLGDGMGVSTVTAARILKGQKKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA
YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAG
TYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP
DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEI
HRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI
ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPG
YVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI
AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLPLLAGTLLLLETATAP