GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:50:00

Sequence ADRA2B_1 : 5665 bp : 62.47% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   2540 1340  0  2   94   93  2084 0.395 200.85
ggcggctgctggtcctgggtgttcccgacctcctaggccccgctcgtccaggccatgggg
ctccagcgccctcggcgccgcccgaggggcgacgctcttgtctagccgagccgggcagcg
ctgtcgtccacggtgcgcactgggcgggcagcgctccctctgcccacctcccgccccgtc
ATGGACCACCAGGACCCCTACTCCGTGCAGGCCACAGCGGCCATAGCGGCGGCCATCACC
TTCCTCATTCTCTTTACCATCTTCGGCAACGCTCTGGTCATCCTGGCTGTGTTGACCAGC
CGCTCGCTGCGCGCCCCTCAGAACCTGTTCCTGGTGTCGCTGGCCGCCGCCGACATCCTG
GTGGCCACGCTCATCATCCCTTTCTCGCTGGCCAACGAGCTGCTGGGCTACTGGTACTTC
CGGCGCACGTGGTGCGAGGTGTACCTGGCGCTCGACGTGCTCTTCTGCACCTCGTCCATC
GTGCACCTGTGCGCCATCAGCCTGGACCGCTACTGGGCCGTGAGCCGCGCGCTGGAGTAC
AACTCCAAGCGCACCCCGCGCCGCATCAAGTGCATCATCCTCACTGTGTGGCTCATCGCC
GCCGTCATCTCGCTGCCGCCCCTCATCTACAAGGGCGACCAGGGCCCCCAGCCGCGCGGG
CGCCCCCAGTGCAAGCTCAACCAGGAGGCCTGGTACATCCTGGCCTCCAGCATCGGATCT
TTCTTTGCTCCTTGCCTCATCATGATCCTTGTCTACCTGCGCATCTACCTGATCGCCAAA
CGCAGCAACCGCAGAGGTCCCAGGGCCAAGGGGGGGCCTGGGCAGGGTGAGTCCAAGCAG
CCCCGACCCGACCATGGTGGGGCTTTGGCCTCAGCCAAACTGCCAGCCCTGGCCTCTGTG
GCTTCTGCCAGAGAGGTCAACGGACACTCGAAGTCCACTGGGGAGAAGGAGGAGGGGGAG
ACCCCTGAAGATACTGGGACCCGGGCCTTGCCACCCAGTTGGGCTGCCCTTCCCAACTCA
GGCCAGGGCCAGAAGGAGGGTGTTTGTGGGGCATCTCCAGAGGATGAAGCTGAAGAGGAG
GAGGAGGAGGAGGAAGAGTGTGAACCCCAGGCAGTGCCAGTGTCTCCGGCCTCAGCTTGC
AGCCCCCCGCTGCAGCAGCCACAGGGCTCCCGGGTGCTGGCCACCCTACGTGGCCAGGTG
CTCCTGGGCAGGGGCGTGGGTGCTATAGGTGGGCAGTGGTGGCGTCGACGGGCGCAGCTG
ACCCGGGAGAAGCGCTTCACCTTCGTGCTGGCTGTGGTCATTGGCGTTTTTGTGCTCTGC
TGGTTCCCCTTCTTCTTCAGCTACAGCCTGGGAGCCATCTGCCCGAAGCACTGCAAGGTG
CCCCATGGCCTCTTCCAGTTCTTCTTCTGGATCGGCTACTGCAACAGCTCACTGAACCCT
GTTATCTACACCATCTTCAACCAGGACTTCCGCCGTGCCTTCCGGAGGATCCTGTGCCGC
CCGTGGACCCAGACGGCCTG
gtgagcccgcctgcgctgcccctgtggggttggtgcggtggcgccggggtcaccctgctt
cttgccctgctgtgtgtggctgcctcccctgggctttctgctccctgcccagatcctgta
ggcctcatcttaggaaccccttgggaggggtgggcaggggggctgctagcaagggtccca

 1.02 Term +   3909   3978   70  0  1   82   55    63 0.270   0.72
ctcaaaatatccacacctcggcaacagtctaagatgagagcctgtgacaggtggcagcgc
ccccaggtggggtactggcatcagagcctggtgcgcccctaggggagcctcccactggag
tgcccggccaggtctccaagccccaaatgagtccttgtgaaccacaactgatccccccag
GTGGGTGCTTGTGGACTGCCTCGGACCCAGCCACGCTGCTCCCCGCAATGCTGATGGGGC
TGTGCATTGA
ggacccctgcttcctggttctcagtcccaccccaaaacctggcacccagaacagttggaa
gtgtggaaaggaggtttatcggccttcccttggagagggcctggcttcaacattgggcca
gtaggcatcttagcttggcaggtgtcgggggaatgggccagatggacctgctagatttgg

Predicted peptide sequence(s):


>ADRA2B_1|GENSCAN_predicted_peptide_1|469_aa
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQL
TREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNP
VIYTIFNQDFRRAFRRILCRPWTQTAWWVLVDCLGPSHAAPRNADGAVH