GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:21:35

Sequence ACTR2_1 : 44721 bp : 39.71% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1270   1317   48  0  0   85   74    44 0.007   3.72
ccacccttttcgtgcaggcattcagctaaatgacgggcggagcccggcggcggcttccgg
tcgggggaaaaaagttgggccgaaggaggggccgggaagacgcaagaggaagaagagaaa
acggccgggcggcggtggctgtaggttgtgcggctgcagcggctcttccctgggcggacg
ATGGACAGCCAGGGCAGGAAGGTGGTGGTGTGCGACAACGGCACCGGG
gtaagggccgcgcgaggaggccttggcggccacagacgccggcggggacgagcagctggc
gcacgggccctcggcccccagggctgcacctccgggccctcggggcgaaggggcgcgggg
cggtgcctcccacctccgcgggcgtgggagcgagccggccgttccctggtctcccttgag

 1.02 Intr +  13212  13322  111  2  0   86   85    94 0.952   8.56
atgccgtgaaagaagttaaaaggagatgttgcgatagattgagtggctacttcgggtgga
ctgaaagcaccaaaagtttaaaatgttatataaatgcaaagtgatatttttcagatgctg
tcttaaaatatagtaaatatcctgatgctaacccacttttattttactgtttcattccag
TTTGTGAAGTGTGGATATGCAGGCTCTAACTTTCCAGAACACATCTTCCCAGCTTTGGTT
GGAAGACCTATTATCAGATCAACCACCAAAGTGGGAAACATTGAAATCAAG
gtaatattttatttattgataaatgataatcaagacatgtgaggtgttcttataaaagta
gtttaacagttcttttaagtagttttaaaatatgttgccatgaaaagcaaaggggagggt
agaagttctcatatttttaatttatatcaacacctgaacaggggcacaaaaattgaagtt

 1.03 Intr +  19884  20099  216  2  0   29  105   236 0.986  17.18
taaaaatgtattatccatgattaaactttctaagacattgttcttgatagaaaagatttt
ctaacttgtggaataaaaagatttattttgcaagtgtcagaaatattaaaattaattatt
cccaagttttcttaaatattatgcaaaactttgatctacagctttgacataattttctag
GATCTTATGGTTGGTGATGAGGCAAGTGAATTACGATCAATGTTAGAAGTTAACTACCCT
ATGGAAAATGGCATAGTACGAAATTGGGATGACATGAAACACCTGTGGGACTACACATTT
GGACCAGAGAAACTTAATATAGATACCAGAAATTGTAAAATCTTACTCACAGAACCTCCT
ATGAACCCAACCAAAAACAGAGAGAAGATTGTAGAG
gtgagtttttatgcaggatatgcatatgtgtatttctgtgatattatgttaaatcaaaaa
ttttcttactgttgctatggataaagagaataaaaataattgttttccttcagatcttat
taagtatctactatatgctagtcattattctaagtaggaaagtaggatagatcagtaaac

 1.04 Intr +  24387  24459   73  2  1  112  100    40 0.992   5.66
gagctctgtggcagcaggacttcaataagaaataagaggagctgatgaaaatggaagact
atttcaggtccatttgattctattttgggcaattaattcactctgtgaccatgaggaaaa
catttatttattatgtaattttctaaataccagtttttttctttctgtctgcatttacag
GTAATGTTTGAAACTTACCAGTTTTCCGGTGTATATGTAGCCATCCAGGCAGTTCTGACT
TTGTACGCTCAAG
gtaggttaagcttaactgttagaaaaaacacttcatcaaacatttattatgtatgtttta
tgtcagagaatttggtttctcaataagttataagccccagaaaactacattatttatata
ccacactttgaaatattttcagtttttaaaatttgtgaaataagattttatatacatttt

 1.05 Intr +  27088  27224  137  2  2   87  115    11 0.986   3.07
aaaagagaacactcgctttaatacttatgcattagaaacaaactgcaaaataactaaata
ataaattctggcttctagttggttacgtttctgttttggcttccctactgtatttggaac
tcgctggctttggttttcctgatttgactttttatttaaatccccctggcttttatgcag
GTTTATTGACTGGTGTAGTGGTAGACTCTGGAGATGGTGTGACTCACATTTGCCCAGTAT
ATGAAGGCTTTTCTCTCCCTCATCTTACCAGGAGACTGGATATTGCTGGGAGGGATATAA
CTAGATATCTTATCAAG
gtaagtgaaaggaaaatatcatggaaattaaattttgtaatttgtttaccaccttaacac
agaattgaatctatcgttttaggattccagcaaatctgtaccactagagaaattatccaa
ttacctcccttatttatataaaaattcatataagatttatacacatgaagaaaaaagaag

 1.06 Intr +  28905  29054  150  2  0   67   98   164 0.999  14.74
aaactgaaatataaatccttttatggcggataaaatcctgcttctgaaatagtaggagct
gaggatccactgcccattctgtttgttattgatgtgacatatttaatgagcattactagc
ttttgcagagtagaactcattcagatgtattatgaacttattgctattgttttgtaccag
CTACTTCTGTTGCGAGGATACGCCTTCAACCACTCTGCTGATTTTGAAACGGTTCGCATG
ATTAAAGAAAAACTGTGTTACGTGGGATATAATATTGAGCAAGAGCAGAAACTGGCCTTA
GAAACCACAGTATTAGTTGAATCTTATACA
gtaagtgtttccagtgtataatatatatgtgttttaaagtggacagccatgattattggt
gtcagcttaaggaggttttcttagaatcagtatttttgtcttgggttgttgtaatatgta
tatgtgtgacttttaatgtctctttctacattaagtttctatttaattattttagggcac

 1.07 Intr +  34607  34752  146  1  2   76   88   177 0.999  14.66
agagcagttacctaaatctatttaatttacctttttttccccaaatatattttaggaaaa
attgttgttggtaatgattttggttacagaacagatgtatttataagtactagtgttccg
gagaacactgggaaattttaatcttttgctgattagtacctgattattcttggtttctag
CTCCCAGATGGACGTATCATCAAAGTTGGGGGAGAGAGATTTGAAGCACCAGAAGCTTTA
TTTCAGCCTCACTTGATCAATGTTGAAGGAGTTGGTGTTGCTGAATTGCTTTTTAACACA
ATTCAGGCAGCTGACATTGATACCAG
gtacattagaagtggtgatttcaaagttatttatcagaaaaatcataaaaatagttttaa
agttatttatcagaaatagatggaattaaatagaatgactaagtttataaacttacttga
aataatttcagacttacggaaaggttgcaagaaaaatgcagaaaacttatctgtatcctt

 1.08 Intr +  38403  38535  133  0  1   79   84   122 0.999  10.63
atgtaaagaggggtcgttacttcacagtagtaataacagcaaatattcagccctgtgatt
tacatgtggaattttatttaattctcccagcaaccccgaggctgacataagtaacagtaa
ccctgagataccattttcctaacctaaaactccaaatgaataaccattgtgcctttctag
ATCTGAATTCTACAAACACATTGTGCTTTCTGGAGGGTCTACTATGTATCCTGGCCTGCC
ATCACGGTTGGAACGAGAACTTAAACAGCTTTACTTAGAACGAGTTTTGAAGGGTGATGT
GGAAAAACTTTCT
gtaagtattagtaaatcaactattactaacattcttttaaaaggctatacagtagtttgt
gaatcttgacaaccaccagagggagcaagacgtcttccaaaacaaattcctactgcagtc
aagtgcatcctggaaatgatagcaagaaggaaatagttcaagataagctctggtcacctc

 1.09 Term +  41924  42094  171  1  0  118   37   249 0.998  19.64
aacatgagctttgggcaaattactaaatgtttctgtacctcaggtaccaaatattacgtt
ctacttatattacaggactgttgcaagtttgagggagagcatatatttaaaaagccattt
tcataaagcagaaagcactgtgcacatgtaccatttcattatcctttctttctcctttag
AAATTTAAGATCCGCATTGAAGACCCACCCCGCAGAAAGCACATGGTATTCCTGGGTGGT
GCAGTTCTAGCGGATATCATGAAAGACAAAGACAACTTTTGGATGACCCGACAAGAGTAC
CAAGAAAAGGGTGTCCGTGTGCTAGAGAAACTTGGTGTGACTGTTCGATAA
actccaaagcttgttcccgtcatacccgtaatgctttcttttttcctttattgccaatct
ttgaactcattcaactccaggacatggaagaggcctctctctgccctttgactggaaagg
tcaagttttattctggtgtcttggggaagctttgttaaatttttgttaatgtgggtaaat

Predicted peptide sequence(s):


>ACTR2_1|GENSCAN_predicted_peptide_1|394_aa
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR