GENSCAN 1.0	Date run: 15-Jan-104	Time: 23:08:40

Sequence ACTR1B_1 : 10353 bp : 57.42% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    890   1042  153  2  0   82   75    48 0.360   3.28
agggcgctctcacgaaggagcgtggcccgaggtgctgggacgcgggaaagacgtctttct
ggaccggtgctgggacgcgggaaagacgtcttcctggaccggtgaatttccagctccaca
gactccggccgcgcgcacaccagcccagctccactttctgccgcccgcgtcccctttaag
ACGGAGCCATGACATCATCCCAGACACTGCGCAGCCTACCTTGGCAACGCCGCGACCACT
TTTTTCCGGACGACCTCAATTGGCTGGCCAGCCTCCGGAGGCCCCGCCCCCTTCGCGCAG
CCAGCCCCGGGCACCTGCTGTCAATCGGGCCAG
gtgggagcgatgattggccgccgggcccgccctccagaaagccccgcggggctcgcgtag
gctgcaggctcggggagggagggcagcggcgccgcgtcgggagccgccgccgtcccggtc
ctcccgcccgcccgcccatccggtgcctcctgcagcccgcctgctgggcagggccggcgc

 1.02 Intr +   1198   1279   82  1  1   79   64   185 0.407  15.99
gggcacctgctgtcaatcgggccaggtgggagcgatgattggccgccgggcccgccctcc
agaaagccccgcggggctcgcgtaggctgcaggctcggggagggagggcagcggcgccgc
gtcgggagccgccgccgtcccggtcctcccgcccgcccgcccatccggtgcctcctgcag
CCCGCCTGCTGGGCAGGGCCGGCGCGGCCCGGCCATGGAGTCCTACGACATCATCGCCAA
CCAGCCTGTGGTCATCGACAAC
gtgaggcccggcagccagggggagggcgggcgccccgcccccgggggcgcacgcggcggc
gcagggagagacccccgcccgcctcggcgcgtcctccgctcactgcgtggccgtcgcccc
cgccgggccgctggcttcgccccgggggcgcgcgccctcttggccttgtaaggccggcca

 1.03 Intr +   4300   4551  252  0  0   97   77   170 0.717  15.67
ctgtggatggtgacggcagccctgccccaccgaagtcaggagcgtgggctgagtcactgt
ggctgcaggaagccgaccctctgcaagggctgggccatggagggctgggttctggcgctc
agacatgcagctgtctctgctgaccgtgccttctgaccctgagcttctcgtcctgcctag
GCCCCCTCTCTAGCCCCGAACCCCATAGGCCCCAGTTCCAACCTGTGCCCCCCAGCCACA
TCCTGGTGTTTGGAGGCCAGGTACCCTCTGGGCGACTATGGTTGGATTTCGGTTTTTCTG
GACACAAGCTCTGCCATGCTCCCTGCCCACCTTGCTGACGTTATCCGTCCTAACAGTGTC
GGGCGGCCGAAGCACATGCGGGTGATGGCTGGAGCCCTGGAGGGGGACCTCTTCATCGGA
CCAAAAGCAGAG
gtaacaccgaggagcctgcctttccctgggggtggggtcctcagttgcaggaacatggca
tgtgttcttgggcctctgctggtgacctcccgggtacctcctccaggctccagctgggaa
gtgctgtgcaggggcacctccccctgagatggggcagcagttcctcttctagggagcatg

 1.04 Intr +   5645   5770  126  1  0   74   48   343 0.999  30.95
aggtgagcccatgctgagttcaggacccgccacagaccctgggacacccagtgagcaggg
gtggttctggtcagggcaggtgaggttctggtcagggcaggtgagggtcagcttccagga
gggcggaaagcagccgctgagcaagggccgggtgccacacctcccttcccaccccaccag
GAGCACCGGGGGCTGCTGACCATCCGCTACCCCATGGAGCACGGCGTGGTGCGAGACTGG
AACGACATGGAACGCATCTGGCAGTACGTCTACTCCAAGGATCAGCTGCAGACCTTCTCG
GAGGAG
gtgtggcggctgcccctcctgcatgctctgcattctcctggccatgcccctctcctctgc
gtccctcctcgccgggctcccacatttcccttctacatttctagagggcctgctgccttt
ccgtgtgtgtctgggtgcgcatacgtacccagtggctgctaggcagaatcttccaaagag

 1.05 Intr +   6119   6243  125  1  2  106   65   200 0.999  20.06
tcttccaaagagagccggatctccggaagagtaactgccagcagataaagggatggggcc
ctcaggaggggtaggaggctgagctgcctgtgcgccagcgggtgtggttctctggaaaga
gccttttagggccttgcaagttgcctcctctgatgcctacaactgtcccgtccctcgcag
CATCCTGTGCTCCTCACGGAGGCCCCGCTCAACCCGAGTAAGAACCGGGAGAAGGCGGCA
GAGGTGTTCTTTGAGACCTTCAACGTGCCGGCCCTGTTCATCTCCATGCAGGCTGTGCTC
AGTCT
gtgagtgctccctaagcctggcctccctgagtcctgtcctccctgtgccgtcctgcttgc
catgaccagggtctgacttccctggaaaaacagccccttgatgactgttcctctagggag
tccctcgtgtcctctcttcagactagataatgcagatgtgccagggttcctcccctgggt

 1.06 Intr +   6479   6731  253  2  1   30   60   266 0.532  16.68
cttgccatgaccagggtctgacttccctggaaaaacagccccttgatgactgttcctcta
gggagtccctcgtgtcctctcttcagactagataatgcagatgtgccagggttcctcccc
tgggtgaggaggtccccgtgcctcagtggctgaggtgaggggatgctgacctggtgacag
GTACGCAACAGGACGCACGACAGGAGTGGTTCTAGACTCAGGGGACGGGGTCACTCATGC
TGTGCCCATCTATGAGGGCTTTGCCATGCCTCACTCCATCATGCGGGTGGACATTGCCGG
CCGCGACGTCTCCCGCTACCTCCGACTCCTGCTGCGCAAGGAAGGGGTTGACTTCCATAC
CTCGGCTGAGTTTGAGGTTGTCCGGACAATCAAAGAGGTGACAAGGGGCGAGAGGGTGTG
GACACGACCTGGG
gtgaggaaagggtggcaccaaggcacaggtgtcccaggtgcagccttctgagggctgtgt
ccctgtccccgcagcgagcgtgctacctgtccatcaacccacagaaggatgaggctctgg
agacggagaaggtgcagtacacgttgccagacggcagcacgcttgatgtaagtggccggg

 1.07 Intr +   6806   6898   93  1  0   98   95   162 0.999  19.22
cctgctgcgcaaggaaggggttgacttccatacctcggctgagtttgaggttgtccggac
aatcaaagaggtgacaaggggcgagagggtgtggacacgacctggggtgaggaaagggtg
gcaccaaggcacaggtgtcccaggtgcagccttctgagggctgtgtccctgtccccgcag
CGAGCGTGCTACCTGTCCATCAACCCACAGAAGGATGAGGCTCTGGAGACGGAGAAGGTG
CAGTACACGTTGCCAGACGGCAGCACGCTTGAT
gtaagtggccgggcctggcactggagtggcagccgatgcccagcctgggggaaggggtag
cccgcttctccaggaagcctgtctgcctcaatcttgtacactaaaggtggggcctgcacg
attccgggcccccgagctgctgttccagccggaccttgtcggggatgagagtgaggggct

 1.08 Intr +   7005   7179  175  2  1   38   79   331 0.912  27.91
tcaacccacagaaggatgaggctctggagacggagaaggtgcagtacacgttgccagacg
gcagcacgcttgatgtaagtggccgggcctggcactggagtggcagccgatgcccagcct
gggggaaggggtagcccgcttctccaggaagcctgtctgcctcaatcttgtacactaaag
GTGGGGCCTGCACGATTCCGGGCCCCCGAGCTGCTGTTCCAGCCGGACCTTGTCGGGGAT
GAGAGTGAGGGGCTCCATGAGGTGGTGGCCTTCGCCATACACAAGTCCGACATGGACCTG
CGCCGGACGCTGTTCGCCAACATCGTGCTCTCAGGTGGCTCAACGCTTTTCAAAG
gtactgtggcttgagagttggtggtggtgagacgaggcccagggcagctggaccctcaga
gagtatacccctacccagagccatattctgttggctttttggtggtgctcaatgaacatt
ttttttaacagaccaaaatttaaaattaaattttgtttactctgtgaatagaggagaagt

 1.09 Intr +   7613   7674   62  0  2   58  100    58 0.953   3.60
gaggacgcagggcccgcaggcagccatggggctggatcatttctcagccttgcccttcat
cctgggaagagctgctgatagaggaccagcagtagctgggggccctgaaggctgggtgcg
ggagctagcagcgaggaggccgggtgcagaccccaggctcagccagctttgtgttcacag
GCTTCGGAGACCGATTACTCAGTGAAGTGAAGAAGCTTGCCCCAAAGGATATCAAAATCA
AG
gtgaggttacagaaactccccctggggcactagggcgctggcagccttggcatggggagg
aaggttgaatgctgcccccagacccgctcaccagctcacgtccacctagtcctgttcttc
ccaaggctgctgctgccactccccagcttatgcctttgctgtcaggcttcaggacctggg

 1.10 Intr +   7930   7970   41  0  2  104   68    47 0.993   2.46
ccccagacccgctcaccagctcacgtccacctagtcctgttcttcccaaggctgctgctg
ccactccccagcttatgcctttgctgtcaggcttcaggacctggggaaggtgaccccaag
gctgggaggatggcttctgggtggggatccacagttaacgtggccacttcctccttctag
ATCTCAGCCCCGCAGGAACGGCTGTACTCCACATGGATTGG
gtgaggcggggctcaagggagggctctgggaggagaccactttaccctggatgctcctcc
cattgttggcctaggccacgtggaggtgggtggatttccctcccaaattagggaaatgca
actctgagcacccaggaaggtggttggctccctgacaggtccacagcaatactatccctc

 1.11 Term +   8162   8264  103  2  1   85   39   163 0.993   9.78
ctcaagggagggctctgggaggagaccactttaccctggatgctcctcccattgttggcc
taggccacgtggaggtgggtggatttccctcccaaattagggaaatgcaactctgagcac
ccaggaaggtggttggctccctgacaggtccacagcaatactatccctccatccccacag
CGGCTCCATCCTGGCCTCGCTGGACACTTTTAAGAAGATGTGGGTGTCCAAAAAGGAGTA
TGAAGAGGATGGCTCCCGTGCTATTCATCGCAAAACTTTCTAG
tgcccaaggagggcggggcatgttgggagagggggagggaggggagacagagcctttaac
cctttttggtcttggctcgtatactaggcttagggtcccctgcatgccctgaacccctgg
gtgggtggcacagcagtgcccccctgcagccttcccctctacacaggacatgcacacaca

Predicted peptide sequence(s):


>ACTR1B_1|GENSCAN_predicted_peptide_1|488_aa
XRSHDIIPDTAQPTLATPRPLFSGRPQLAGQPPEAPPPSRSQPRAPAVNRASPPAGQGRR
GPAMESYDIIANQPVVIDNAPSLAPNPIGPSSNLCPPATSWCLEARYPLGDYGWISVFLD
TSSAMLPAHLADVIRPNSVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYPMEHGVV
RDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFIS
MQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRK
EGVDFHTSAEFEVVRTIKEVTRGERVWTRPGRACYLSINPQKDEALETEKVQYTLPDGST
LDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVLSGGSTLFK
GFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGS
RAIHRKTF