GENSCAN 1.0	Date run: 16-Jan-104	Time: 00:00:36

Sequence ABCG8_1 : 41259 bp : 46.18% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1263   63  0  0   91  109    29 0.930   6.69
agtgggcagaacacacacgtttgtaggtgggcttgccagcaaggaatgctgggagagacg
ggcccagggcaggaggccgaggtgtccctgctccaggaaacagagtgaagacactggccc
tggcaggcagcagctgggtctaagagagctgcagcccagggtcacagacctgtgggcccc
ATGGCCGGGAAGGCGGCAGAGGAGAGAGGGCTGCCGAAAGGGGCCACTCCCCAGGATACC
TCG
gtgagtgagcaatgggaagtcggcccaggcctggtgggcgggtaggagaaatcaaacctt
tctctcttccctcaggagccttctgtcctagcaccacccggacatcaagcagtgtgagga
catggccgcaggactgtttcctgcatgtcaaagggcggaggggaacagattcagggtccc

 1.02 Intr +   6654   6755  102  2  0  126   80   108 0.991  14.17
tcagcactcctattttcccaaagccctgaggttccacctgtgcaatcccatctgttgcca
atttgagatttaaccacgtcggctctaagaagttgctctcacctgttggtttccttcttg
tcttctcctatgttctcagcagcttctaaaggagcccctcatctctcctgtctcccacag
GGCCTCCAGGATAGATTGTTCTCCTCTGAAAGTGACAACAGCCTGTACTTCACCTACAGT
GGCCAGCCCAACACCCTGGAGGTCAGAGACCTCAACTACCAG
gtagaggcacgcctgggttcaaggggagaggagcaggcagggacagccaggaaattcccc
gggtggaaataaaagggtgggcccaacttgcaggccctctgcccgcaaggacagagtcca
gtccacattgatgcctcacgtgtcaggtgcaataggtgtcatcaatggcatatatcagag

 1.03 Intr +   8302   8458  157  0  1  100   86   107 0.950  11.28
ttctcagcatgggtcctgcttccgtgtttggtagaacctgggttggggcctattgtgtgt
aggtgaggacatatcctctgtggagaggggccacctggggaacgaagatgctgaacagaa
gttgctgaagccctctgaaccattcagctctctaaggaaccttctgatatctccccacag
GTGGACCTGGCCTCTCAGGTCCCTTGGTTTGAGCAGCTGGCTCAGTTCAAGATGCCCTGG
ACATCTCCCAGCTGCCAGAATTCTTGTGAGCTGGGCATCCAGAACCTAAGCTTCAAAGTG
AGAAGTGGGCAGATGCTGGCCATCATAGGGAGCTCAG
gtaccggaaaggcaaatcgctgggcaatggtttctctcctgggatacagaatggtccttt
ggacaaatggatgcttcttatggagctctttgctgactagtagaataatacagcagaatg
gctgagaacacaggttctgggtcagacagacctgggctcaaatcctggctcctccatttg

 1.04 Intr +  13731  13969  239  1  2   59   55   245 0.955  15.63
gagctccatgtcctgggcccaccccatctaggtccagggactatgccacctctctagggg
ctggtcacatctgcacggacagagtagtccggggtcctggagagtgtatggggagcagtg
gctgacagcctggcccccacagaagctccgctctcagggatatccctggtggctttgcag
GTTGTGGGAGAGCCTCCTTGCTAGATGTGATCACTGGCCGAGGTCACGGCGGCAAGATCA
AGTCAGGCCAGATCTGGATCAATGGGCAGCCCAGCTCGCCTCAGCTGGTGAGGAAGTGTG
TGGCCCACGTGCGCCAGCACAACCAGCTGCTCCCCAACTTGACTGTGCGAGAGACCTTGG
CCTTCATTGCCCAGATGCGGCTGCCCAGAACCTTCTCCCAGGCCCAGCGTGACAAAAGG
gtaactaactggccccagtggtgacccccaggtccaagaagctacagtgtccatgccccg
ctcctcccctgctgccttgcctcaggacccagccgcaggtcgagtttgaacaactcagct
tgccttccgccagccctgggctgcagcccaccctccaccctcctttcaaaccccacagcc

 1.05 Intr +  14501  14633  133  1  1   96   94   157 0.986  17.32
cgggacctgtggaaagaatcaggggaaccaatgttgcagcttggaactcaagtgctggag
ctgtctcccttcactttcaaacccagccggaggagcgggcgcctttatccttggggtcac
aatgtgtccagccctgaaggaggcccctgaggtggcctcaaagctccttctggcccacag
GTGGAGGACGTGATCGCGGAGCTGCGGCTTAGGCAGTGCGCTGACACCCGCGTGGGCAAC
ATGTACGTGCGGGGGTTGTCGGGGGGTGAGCGCAGGAGAGTCAGCATTGGGGTGCAGCTC
CTGTGGAACCCAG
gtgagggcctggggggcagatgggggcagagggacctgtgcggtcccctcaggcttggct
tggtctggccagagccccaccgactcaccaggctcctctctgtgttggaaaggaatcctt
attctcgacgaacccacctctgggctcgacagcttcacagcccacaacctggtgaagacc

 1.06 Intr +  14746  15015  270  2  0   55  101   299 0.987  25.41
cgtgcgggggttgtcggggggtgagcgcaggagagtcagcattggggtgcagctcctgtg
gaacccaggtgagggcctggggggcagatgggggcagagggacctgtgcggtcccctcag
gcttggcttggtctggccagagccccaccgactcaccaggctcctctctgtgttggaaag
GAATCCTTATTCTCGACGAACCCACCTCTGGGCTCGACAGCTTCACAGCCCACAACCTGG
TGAAGACCTTGTCCAGGCTGGCCAAAGGCAACCGGCTGGTGCTCATCTCCCTCCACCAGC
CTCGCTCTGACATCTTCAGGCTGTTTGATCTGGTCCTCCTGATGACGTCTGGCACCCCCA
TCTACTTAGGGGCGGCCCAGCACATGGTCCAGTATTTCACAGCCATCGGCTACCCCTGTC
CTCGCTACAGCAATCCTGCTGACTTCTATG
gtgagtccccaaggccagcagccagggccctggcacacagggcctccccgatgcttaaac
cctgcccaagcttgctggaaagattcaggggagaaactcccagaggtttcaggagaggag
gagcaatgatggggaagaacatggggtggtttgccaggtatcaaatgctagaaatgaggg

 1.07 Intr +  34123  34285  163  2  1  107  116   111 0.999  14.83
ccttggggtccctctgcctctctctgctctgccccttgcttcatggctgagggtggggag
aatgtcccagagccccacgaggggtgatcagcattgtgagctgggcgtgcaccaagctct
tcacctgtgagcaggtgccagggaacaggccacctgtgactccacatcccctgcttgcag
TGGACCTGACCAGCATTGACAGGCGCAGCAGAGAGCAGGAATTGGCCACCAGGGAGAAGG
CTCAGTCACTCGCAGCCCTGTTTCTAGAAAAAGTGCGTGACTTAGATGACTTTCTATGGA
AAGCAGAGACGAAGGATCTTGACGAGGACACCTGTGTGGAAAG
gtaaggtggcaggcgactctgagaggagagctccctgcagaaggtggctgcccccatgac
ctggccacatcttctgcctcccagcagcgtgaccccactagacaccaactgcctcccgag
tcctacgaagatgcctggggcggtgcagcagtttacgacgctgatccggtaattatctgt

 1.08 Intr +  34370  34453   84  2  0   88   48    52 0.425   0.14
actcgcagccctgtttctagaaaaagtgcgtgacttagatgactttctatggaaagcaga
gacgaaggatcttgacgaggacacctgtgtggaaaggtaaggtggcaggcgactctgaga
ggagagctccctgcagaaggtggctgcccccatgacctggccacatcttctgcctcccag
CAGCGTGACCCCACTAGACACCAACTGCCTCCCGAGTCCTACGAAGATGCCTGGGGCGGT
GCAGCAGTTTACGACGCTGATCCG
gtaattatctgtcattttattactgaacccgcccccctgcccaagtctttgtatatcaca
ttaagccctttctattaaagtgaatttaaaggagaaagtgagaggtagagtcatttgaaa
aaaacagcatccagcagggcgttggtggcttatgcctgtaatcccagcactctgggaggc

 1.09 Intr +  35934  36133  200  0  2   55   82   304 0.972  25.49
tgtgggacagatgctgtcatcagttttctgatttaatcctcagagccactctatgaggca
ggtattaccatccccattttgcataggagaaaaatgaggcttatggagactgtgacattc
ccagggtcacggggctggtgtatgctgttgcctcagcatctcttccttttggtttttaag
TCGTCAGATTTCCAACGACTTCCGAGACCTGCCCACCCTCCTCATCCATGGGGCGGAGGC
CTGTCTGATGTCAATGACCATCGGCTTCCTCTATTTTGGCCATGGGAGCATCCAGCTCTC
CTTCATGGATACAGCCGCCCTCTTGTTCATGATCGGTGCTCTCATCCCTTTCAACGTCAT
TCTGGATGTCATCTCCAAAT
gtgagtgtggcccactggcatgggcaggcaggacctcagccacctccaagctgtgttcct
ctgagctcctggggagcgggtttgatttcattgtgattgtgatatataagacaataatgt
ttttaaagtttgcatgttaatattagcatacaaatgaaagtaaattaccgagtcttagct

 1.10 Intr +  36554  36630   77  0  2  115   57    63 0.954   5.13
ctgaagagcctcatcaaacatctaaattaggatggctttactgtgcctatttaaaaaaaa
aaattagagacttgggcaatatgataactactttgaattgtattaagagagtctccaaaa
cagaagcactgtagatttattctacttcttcattctcttttcctttcccttactttttag
GTTACTCAGAGAGGGCAATGCTTTACTATGAACTGGAAGACGGGCTGTACACCACTGGTC
CATATTTCTTTGCCAAG
gtgactgggcagggttgagagcaagtgccccccacccaccagggtgggggtaagtgtgga
gaaaacgttgctacaaggaaggcttttctgaaccatggggccgtgggtcatgtgaagtca
ccgatgccaccagatgccacattttctaggggagtttcagagacttgaacttttatttta

 1.11 Intr +  37293  37560  268  2  1   61  110   343 0.930  30.91
tctgcaagggggaggccagcactgagctcatgctcctgggtcccagcacaccctcctgcc
acagcctcatcatcaccaggagggaaggttgctatctgggggcactgctacttttaaacg
tttataataatggcagtgaaggtgctggcttcatatccttgcaagggctgttctttgcag
ATCCTCGGGGAGCTTCCGGAGCACTGTGCCTACATCATCATCTACGGGATGCCCACCTAC
TGGCTGGCCAACCTGAGGCCAGGCCTCCAGCCCTTCCTGCTGCACTTCCTGCTGGTGTGG
CTGGTGGTCTTCTGTTGCAGGATTATGGCCCTGGCCGCCGCGGCCCTGCTCCCCACCTTC
CACATGGCCTCCTTCTTCAGCAATGCCCTCTACAACTCCTTCTACCTCGCCGGGGGCTTC
ATGATAAACTTGAGCAGCCTGTGGACAG
gtaaggcctgcccccggggcctgggccagctttgttaggactcatgtgactggatgaagc
ctgctttcatctggagatggacacttatcacttagatccaactcgaggctggcccttctg
gaagcagaggcctttgcccactgccctggaggccaaaggaatgattccattagagattcc

 1.12 Intr +  38527  38669  143  2  2   49   93    84 0.566   5.07
atcaaatgtgtgggtgaccccgtggcctctcagctccctcggccccagtccatgtcccca
gcaacccctctgcccttttgcctcttggtctctggtctctctcccctccttgctcatcag
agaacttgggccagagccaccatggccctgtctcagagagtgggatgtgcccttgtgcag
GTAAGAGAGACTGTGTGACTGTGGGGAGACCATGGGAATATGGGGAGACTGAATACGGGG
GAGACTGTGTCGATATAAAGGAGATCATGGGAATACGGGGAGACCATGAGAATAGGAGGA
GACCGTGGGAATATGGGGAGACG
gtgagaatatgggaagactgcaagaatatagggagaccatgggaatatggggagactatg
ggaatatggggagatcacatgaatatgcaggagactgtgagaatatggggagaccgtgag
aatatggggagactgtgggaatatgaggaaagtgtgaatatgggggagaccatgtcaata

 1.13 Term +  39923  40060  138  1  0   99   37   264 0.760  20.36
tggtgttttgaagggctgatgaagattcagttcagcagaagaacttataaaatgcctctc
gggaacctcaccatcgcggtctcaggagataaagtaagcggggaaggcctcgggttctaa
attattggacgtccggctttccatcctcctcatgagcccactgcatgtctgtgtctccag
ATCCTCAGTGTCATGGAGCTGGACTCGTACCCTCTCTACGCCATCTACCTCATCGTCATT
GGCCTCAGCGGTGGCTTCATGGTCCTGTACTACGTGTCCTTAAGGTTCATCAAACAGAAA
CCAAGTCAAGACTGGTGA
ttcacgccagacgtctgcccgctggtgggggacctgagcagacccttcaactgcactccc
tcctcaggagccccttcctggggacagtgaggacaatgaccctacagatgctcagctaca
tccggcccagggtgctgcagtggcacagaccagccacaggatggcagtagaataaagaca

Predicted peptide sequence(s):


>ABCG8_1|GENSCAN_predicted_peptide_1|678_aa
MAGKAAEERGLPKGATPQDTSGLQDRLFSSESDNSLYFTYSGQPNTLEVRDLNYQVDLAS
QVPWFEQLAQFKMPWTSPSCQNSCELGIQNLSFKVRSGQMLAIIGSSGCGRASLLDVITG
RGHGGKIKSGQIWINGQPSSPQLVRKCVAHVRQHNQLLPNLTVRETLAFIAQMRLPRTFS
QAQRDKRVEDVIAELRLRQCADTRVGNMYVRGLSGGERRRVSIGVQLLWNPGILILDEPT
SGLDSFTAHNLVKTLSRLAKGNRLVLISLHQPRSDIFRLFDLVLLMTSGTPIYLGAAQHM
VQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFL
WKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLPTLLIH
GAEACLMSMTIGFLYFGHGSIQLSFMDTAALLFMIGALIPFNVILDVISKCYSERAMLYY
ELEDGLYTTGPYFFAKILGELPEHCAYIIIYGMPTYWLANLRPGLQPFLLHFLLVWLVVF
CCRIMALAAAALLPTFHMASFFSNALYNSFYLAGGFMINLSSLWTGKRDCVTVGRPWEYG
ETEYGGDCVDIKEIMGIRGDHENRRRPWEYGETILSVMELDSYPLYAIYLIVIGLSGGFM
VLYYVSLRFIKQKPSQDW