GENSCAN 1.0	Date run: 15-Jan-104	Time: 22:24:03

Sequence ABCA12_1 : 209284 bp : 37.25% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +  10713  10852  140  2  2   37   78   162 0.022   9.76
ggtagaatagctgggttgctagacccagaagagagacaacaatcactgctcttggctcac
aggaagccacatccacaggaaaagggggagagtactacatcaagggaacaccccatggga
caaaaaagtctgaacaacagccttcagacatagatcttccctctgacagagcctacccaa
ATGAGAAGGAAACAGAAAACCAATGCTGGTAATATGACAAAACAAGGCTCTTCAACACCC
CCAGAAAATCACACTAGTTCACCAGCAATGGATCCAAACCAAGAAGAAATCCCTGATTTA
CCTGACAAAGAATTCAGTAG
gttagttattaagctaatcagggagggaccagagaaaggtgaagcccattgcaagggaat
ccaaaacatgaaagaagaagtgaagggagaaatattcaaggaaatagatagctttaagaa
aaaaaaatacaaaattaggaaactttggacaaacttttagaaatgcaaagtgctctggaa

 1.02 Intr +  15317  15387   71  2  2   16   75    93 0.023  -1.29
ggtcataatcaaaaaagagtagacattggcatggatgaggtgaacagggaacacttctac
actgttggtgggaatgtaaactagtacagccactatcaaaaatagtgtggaaattcctta
aagaactaaaactagaactacaatttgatccagcaatcccactactggatatctacccag
AGGAAAAGAAGTCATTATTCGAAAAGGTACTTGCACACACGTTTATAGAAGCACAATGCA
CATTCGAAAAG
gtacttgcacacatgtttatagcagcacaatgcacaattgcaaaattgtggaaccaaccc
aaatgcccatcaatcaacaagtggattaaaaaactgtggaatatatatgtgatggaatac
tacgcagccataaaaaggaatgaattaacagcatttgcagtgacctggataagattggag

 1.03 Intr +  27939  28032   94  1  1   81   89    63 0.596   3.80
ttacaggtcttttacatattaaaaaaatctctcattcactttttattaataatatctaca
gttggtcaaatattcagcttgtgttgaaatattatagtatgacatactttttgtagtcag
gttttaaaaatctttggttcaacaataaaactaacaattttttctaccattattttgcag
CTTTGGACACTTGTCTTGATCTTATGGCCAGTCATTATTTTCATAATTTTGGCTATTACT
CGGACCAAATTTCCTCCAACTGCAAAACCAACTT
gtaagtaaatgacatttgtttatttccttaatttttggattctagttaaaatttattttg
gtaccactttagtgtttcatttcaaaaatttttttttgtatagtgttttcacttggaagg
attaatatgaacaatttgtgtgttttttaccctagattttcaagttagtcagaaagttga

 1.04 Term +  31948  32065  118  1  1   32   38   197 0.613   6.13
aatagctcctcttaacaattcgggcactggagtcataacaacatgcatggatcccacaac
aacttctgttctgtaatactgtgggtacattctgctcccagaagagtcaggcaggtctgt
aggacttgataactcatttagaacaaatataattagtgacgtaaaggattcccttcatag
TCTTTTTGATGGTTGGGCATCTGGAGAAGTCTGCATTTTTGATGAGCGGGAACCAGCTGC
AATCCCTGACACCATTGGTGCTGGTCCAGATAACATAGATATTCCTGACATCACCTGA
cttcactcattcccttttgtgttgcaacaaatggcttaggtaactagcctctgcaaagaa
taaatcccaggtgaagaaaaccttttgagcctggcaggcaggccctaattcttctcattc
aaacagggaagaaatgagctgaggtgccaagtttgaagtagtttcaatctcttataatct

 2.01 Init +  47526  47653  128  2  2   51  109   114 0.657   9.48
ggcaccagaggtggggagttttaaggggtctagcagcctggccatcaatacccacaacag
ttatggaggcaagggaaacaggcccttgaaaagaaggtaatgtggagtgggtagcctcca
tattgattaagaagggaacggacttaccctccactgtaagagttaccaaaaacgtctgtg
ATGGTCCAGGAGGCTTCTGAGGCCATCAGGCAGCATCAATCTTCAGCTGCTAATCTGAGA
AGATCTGGGAAGGAGTCAGTCAGAGAGCTTTGGGCCAGCATTCCAGGGGCTCTGGGAGTG
GCTGCCAG
gtgagtaggacagtctgatttccagtggggtccctcacagacgggacacagcttaggagg
aatcctgggctgtgggcattccttggcccagtggccagatttccggcacttgaagcaaga
tcctgggggaggacgtcctggaggaacacctggccactgcagtttaggcattttgaagtt

 2.02 Intr +  65733  65856  124  0  1   23   59   105 0.018   0.77
gaaaaatttaaagaaggaaaggaagacatgttctgtaatcagatcatggaaatctggaat
taaccaaagttattcaggttttttactgaaaaacttttcagagtctttaatatgcaaata
tattctggctttcccagaaggggagatagagtttagtttcctaagctcatttggccccag
AGTCTGGTTTAGAGGAATCCCCGATGCTTCCCCACTCTACTCCTCCAAACCCCAACATCA
CATTGGAGATCATAGTAACAGGAGAGGAATTAAATCCTCAACTCGTTCTCTCAGTGCAGG
CTTT
gtgagttaactcctagatgcctaggtgatcagcaacacagttaactatgagcacagcact
tccctcctcaatcagaacagatgcagtggcactgcaggaagtaccactcccccagtgtac
cattcctccagggtacccctcctttcctggatgctaagtggtgttgctggatctgtggaa

 2.03 Intr +  69847  69937   91  0  1   -8   98    68 0.031  -3.15
ccatttattcacatatttaaaattgtttacaatgtgtgaagcattgtgctaagaactatg
taaggttttttctttcttttaaatagcttatttttttatccagtctcttaaaaagacgca
attttactaggttagagtctctattagcaagttcgaagtcatattggttttcagccctag
GCTGAAGTCACTCTAGGCCACATAGGTGTAGAAGCCCTCATTCCGAGGGACTGGAATCAG
GAAGAACTGGTGTATTTGATTTTATCTGAAG
gtgggtggtggacaggacacctcccctcagtaagtagactgatccctcaaatgaaaggtg
catgcgaaggagaacaggaacagatctacaggctcctgatataatgttacgaactacttt
gaaaggccaagtttatatcatttacaatttaacttgtcttttcaagtgtaaccgagaaca

 2.04 Intr +  75410  75563  154  0  1   98   75   106 0.436   8.51
aacaccctccaagactgctcctactcagtggtgagtgttagttgcagagttggggctcag
ttgggggacccggagagtggtaatccaggaggttaacttcacaaagtggagttactgcat
ttatgttctttcccagacaaatgtgccatactgatgtaatgactgtttttttaattttag
GTTACCTCGCACCTCGAAACCTTCCTAGTACTGGATTCTTTCCATTCCTGCAGACCCTAC
TCTGTGACACAGACTCTAAATGCAAAGACACACCCTATGGCCCACAAGATCTGCTTCGTA
GGAAAGGAATTGATGATGCACTATTTAAAGACAG
gtgggggcacttctcaagtgtgttcaattgttctgagagatcaaatcttgtttccttctg
agatagccaggaagccatgcaagcttagatatgcaattttgttttctctgtctataaatg
tgatgatctaaatatgaaataacaaagtaggtataaactggaataactgtttatgtgaga

 2.05 Intr +  81324  81523  200  0  2   79   52    71 0.100   0.67
agctatttagagttcctgaataggatttttatctctcctgatttggtttggtcatgggga
ctggaaatggggatgagttgaataattccattatctgtcattgcacagggtttctcaacc
ttgattctcaactactcataactgggaccagataattctttgttgtgttgtgcattgtag
GATGTTCAGCAGCACCCCTGGCCTCTACTCACTAGATGCCAGTGACACTCCACGCACAGT
TGTGACAACCAAATATGTCTCCAGACATTGCCAAATGTCCCCCGGGGTAGGGGTATTATC
CACACTTGAAAACCACTGGGCTAATAGAAGGCTGAAGGAAAAATGTTTCTGGTTGCAAGA
GGCTTGCATTAAGGATGTGA
gtaaggatattgctctataacaaacacaaatgggactaactcagatttaggggccctgtc
atgtgttccagtcctcctttgcacatgtccttacttagctattctcattaatgtaccata
atccctggttttcttattttacttgcccattattttacatataataagaatgtaatcaat

 2.06 Intr +  87044  87141   98  0  2   78   88    88 0.936   6.61
agaaaaactcatggaatttgccacttttccagtataaaacttccatggaagaggcatgtt
tgagcacatccttgctgtagggtatatgaggtcacaagtgatgtttatggattctcatgt
ggtcctgtgcatttgtgtgtgtgtgtgtggaatgctaatctgttccttctttgattacag
CCACAGTATTTCCCAGTCCAAGTTCTGATTTGGAAATCCCCGGAACATATACTTTCAATG
GCAGTCAAGTGCTCGCACGAATTCTTGGCTTGGAAAAG
gtaacttgattcaattttgtaatgggtagagtgattcaacataggccttttaggttaata
gaaggatctctcaaatagcaagatgtttggagcacctttcctatttagggtaatatctca
ggcaacttcttttcttaggaacccttcaataaacagcttaattttaagacattctgaatt

 2.07 Intr +  89817  90002  186  2  0   46  109    79 0.933   4.76
attcgctctacaagtttcatgggtaaactctatctactttattgttattttaatagctgc
tataatggaggacctcaaaatggctattttgaagacagcttagattccttgaagaataga
atatttgaacatctacatttattaacactcttattttactcttttcacacatgcttttag
CTGTTAAAGCAAAATTCAACTTCAGAAGATATACGAAGAGAACTATGTGACAGCTATTCA
GGATACATTGTGGATGATGCCTTCTCTTGGACCTTTCTAGGAAGAAATGTTTTTAACAAA
TTTTGCCTTTCTAACATGACCCTTTTAGAGTCTTCTCTCCAAGAACTAAACAAACAGTTC
TCCCAG
gtgagtgtagatctttgatccacaaagtgactcaacatgaattaaagggtaaatctatag
cccgtgtagactgggaaatgctgactgggatatttgtttaccttaggcatgttttcctca
catagacatttgcacacaaagtttaatcttaagtagtattacttatttaatgtgaaaggt

 2.08 Intr +  93613  93791  179  0  2   46  110    93 0.975   5.10
ttaagaacattagaagtagttgctggttttccaaataaaagattggcttcaaactgagtg
aaggtctaaaagaattgcttatgtgaaaatctagatttttgatgcttttaaaaacagcaa
accatgtgattacaaatgttaaagtctcattttgctctgtttgtggttttatattttaag
CTATCCAGTGACCCCAACAATCAGAAGATAGTGTTTCAGGAAATAGTCAGAATGCTGTCT
TTCTTCTCACAAGTGCAAGAGCAGAAAGCTGTGTGGCAGCTTCTGTCTAGTTTTCCAAAT
GTGTTTCAGAATGACACATCACTAAGCAATCTATTTGATGTTCTTCGAAAGGCAAACAG
gtaagaaaatgtaagaattaaatgtaatattagtgttcacaaagaagtgtttaaaaaaat
gttacctgtgatgattactgttatctgggttatttaaacacagagcaaataatccttcag
cctcttattgcagattttagcagtgaaggtgagtgtattagttaagcaaagaagaaacat

 2.09 Intr + 102563 102675  113  2  2   50   62    92 0.101   1.90
attttgttgagattttgtgcatgaacagacaaacaagtaattaaattacaaaaagtagca
tcttgtcttttatattataagaataatttatactgtagccattttctccttgaataatct
tttgtttctgtctgcaaaccttgaaacagaatctggtttaattgctttttgactccttag
TGTGCTGCTGGTTGTGCAGAAGGTTTATCCACGTTTTGCAACTAACGAAGGTTTCAGAAC
CCTCCAGAAGTCTGTTAAACATCTGCTGTACACTCTGGACTCCCCAGCTCAAG
gtattatatttccatcttactgtgttaaattcagtgtcacaaagcccattggaaatataa
agcagagtgcaatgaaagtaatcatgtagagatgatattattcttaggtggggacatatg
ctatgaataaatctggatctcgagttaatcaaagtgtggagaaagggagaaatggccaag

 2.10 Intr + 107732 107807   76  0  1   54   98    60 0.416   1.25
aatatcacaaatatttccaacaaaagagcatagatgtcttttatacaattcttttgagaa
tgattctgcagatttctgcattttctcctcattaatttgacctgggatggttttcactga
ggaaaaaaatctttaagcaaacatgttaaatgtttacctatataaaaattattacttcag
GTGACTCCGATAATATAACGCATGTGTGGAATGAGGATGATGGACAGACCTTATCTCCAA
GCAGTCTGGCTGCACA
gtaagtctttgtttatttctaaataggtagataacttggctgaataaacaatcaaaacaa
tttctaaacataattcgcttatcagtgtatataagcatggaatagaaaaatcaactattg
actgagcagaggaaagggcatagtccaagtgtagtaaagttgaaacttattttttgatat

 2.11 Intr + 112690 112808  119  1  2  104   90    44 0.832   5.39
ctcgtctcggcctcccgaagtgctaggattacaggcgtgagccaccgcgcccggccaact
gcatagtatttcaatgtccaagtcaaccaatgccaaacaagggaccaaaatgatctcaac
aaaacggctttgctttacttttatatgtcttaatttctatattcttttctaattctgcag
GCTCCTAATTCTGGAAAACTTTGAAGATGCCCTCTTAAATATATCAGCAAATAGTCCTTA
TATTCCTTACTTGGCATGTGTGAGAAATGTGACTGACAGTTTGGCCAGAGGTTCACCAG
gtaatactgttcttaacagtcaaaatgctgctcatggtttctacctctgttctaaagtag
tgagtttttgaggcatttgcttacacaggaaagaaaatttgtaaaatcttagtttccata
tgcatcagtttcagtctggtgatttgatatacaaagggaatgtcttgtcataatatcata

 2.12 Intr + 113849 113955  107  0  2  130   80    66 0.980   9.01
actctgttgtccccatggttcaaataaaggttaaattttcattcatcttatgtttgtatt
gaggtaggctattatcttaggaaaaatttagtaataagtcaggatagaggtgtctttcaa
actggtttcctaaatgaccttgcaattcacataaagtaactcttctcccttcctttacag
AAAATCTAAGACTCCTGCAGTCCACAATACGATTTAAAAAATCTTTTCTTCGCAATGGTT
CCTATGAAGATTACTTTCCTCCAGTTCCTGAAGTCCTAAAATCAAAA
gtaagccatgaaagtaaaaaaaaaacaaaaaacaaaaaaaaaaacaaaaagacaaaacaa
acaaaaaaaaaaccttaacacttctcataatatttggcaagatacacttttaagttttaa
atctgatctttgtaaataatgatgctattttaactctagatttataatggccctacttac

 2.13 Intr + 119832 120088  257  2  2   41   89   214 0.961  12.12
taaactcaaatgacagacggtagtacttcataataaaactaacgccaaatgccaactaac
cacatacataggcagaatgtttttcttaaaggaaatcaattgtggttgcttattatcaac
tactatatatgtagaaaaatgtaactaatctatttcccactcttttccctttttggaaag
CTGTCTCAACTTCGAAACTTGACCGAACTTCTTTGTGAATCTGAAACTTTCAGTTTGATA
GAGAAGTCATGCCAGCTCTCTGATATGAGCTTTGGGAGCCTGTGTGAAGAAAGTGAGTTT
GATCTGCAACTCCTCGAAGCGGCAGAGCTGGGCACCGAAATAGCAGCCAGCTTACTGTAC
CATGACAATGTCATATCTAAAAAAGTGAGAGATTTGCTGACTGGAGATCCAAGCAAAATT
AATTTAAATATGGATCA
gtaagtttttccattgtcttcttccttggtgaaatctctttcaaaatattgaaatactta
gttgaatttcttcttttctgttttgttccaggtttctagaacaggcactgcaaatgaatt
acttggaaaatatcactcagttaataccgatcatagaagccatgctgcatgtcaataaca

 2.14 Intr + 120180 120292  113  0  2  106   37    96 0.999   5.40
agcttactgtaccatgacaatgtcatatctaaaaaagtgagagatttgctgactggagat
ccaagcaaaattaatttaaatatggatcagtaagtttttccattgtcttcttccttggtg
aaatctctttcaaaatattgaaatacttagttgaatttcttcttttctgttttgttccag
GTTTCTAGAACAGGCACTGCAAATGAATTACTTGGAAAATATCACTCAGTTAATACCGAT
CATAGAAGCCATGCTGCATGTCAATAACAGTGCAGATGCTTCTGAAAAGCCAG
gtgtttccccatccacattttaaatcttgtcttattagaatgcatgtgattctcacgctg
cagtttaagaaagcttttttgaagttcccaaccaaactcgctttgctatctgcccttaca
catgagaaacctgaagcattcaaatatggttacttgtctaaagtaaacacacagaaagct

 2.15 Intr + 121496 121620  125  0  2  112   59   148 0.999  13.68
acaaatctaaatcagatagaaatagatcctaaatatgcaacgtttgccaaaactgggaga
catctgcccctgagaaggcacgtatgtcttagtctagaaggtttctctatgttagtcata
ctaaaaagagtgacctgacaaaccaacatgggttttctttttacatttttcttcttgcag
GTCAGTTACTAGAAATGTTTAAAAATGTTGAAGAGCTGAAAGAAGATTTAAGGAGAACAA
CAGGAATGTCCAACAGGACTATTGACAAGTTGCTGGCCATTCCCATCCCTGATAATAGAG
CTGAG
gtggggtgtcatgtgtttgtacttacatgcagttcttagaaatttaaatagcatttagca
tttgttgagcgcttaccagttaaacactgagaagttgcatgctaatctggtgaattttct
atgcaagtgataaacctggaggcctcattaaagatagaagaaaaattctgaagcaagaat

 2.16 Intr + 123965 124142  178  1  1   93  -52   121 0.440  -2.83
tgaactattaattctctattgtcttattaatagtaattagtgctttagatgaaaagttgt
ttgattcttgaggaccttttgttttagtttaaaatttagagtatacagaaaacctcacaa
aatgaacagttgactctcgaatgattcacagttgaaatatttttcttcctccatttgcag
ATTATTTCTCAGGTGTTCTGGCTGCATTCCTGTGATACTAATATCACCACTCCCAAACTA
GAAGATGCAATGAAAGAATTCTGCAACCTGTCTCTTTCAGAGAGATCCCGGCAGTCTTAC
CTCATCGGACTCACCCTTCTGCACTACTTAAACATTTACAACTTCACATACAAGGCAA
gttgctgttggttaaatatgtttatattcatggtttatataaaactatttaattatacat
ttatgttctctgatactatgagggatgagatccatttattcggcttttggaattattgca
ttatgttaaagctaaatgcaaccttagagatcatttattgcaattttgcacgttttatag

 2.17 Intr + 127493 127657  165  0  0   75   69   122 0.837   8.01
tctcttaggtaaacgcccaggaatggaattgtcaggttgagtgttaaatttacatttaac
tatttaataaacttcaaaaatgttttccaaagtggctgtacctttctacaaccttaccaa
caatgcatgaggattcaatttttccacataaagcatttatttttattctgtttctgttag
GTGTTTTTCCCGAGGAAAGATCAAAAGCCAGTAGAAAAGATGATGGAGCTCTTCATAAGA
CTAAAAGAGATTCTCAATCAGATGGCTTCTGGCACACATCCGCTGCTAGACAAAATGAGA
TCCCTGAAGCAAATGCATCTGCCCAGAAGTGTTCCATTAACACAG
gtagcaaagtcacccagtaatgttcttgttgaaaaatgccttctgtcatattgagtagtt
ataatacattcagcttcaatcgtagtacattgaaaaaaaaaaaaacaacacctacaagaa
aactcttctacctagcaacactttttgccactttaattagtgaagtttattgttcttcat

 2.18 Intr + 131449 131501   53  2  2   42   99    42 0.683  -1.59
cttgtgtatcggttttatgtagcagtatttttatttcaataagatgaatgttcagaattg
aggggttgaaggatattgcattttattttaatagccattgtcaaattgctttccaaaaac
ctctaacatctattctcagcagcaatacgtgagaatatccttctgctatcctcgaactag
GATGTTTCTTTAATAGTAAAGTTAAGTGTGTCGTTGGTGAAAATGAAAAACTG
gtaagaactccagaagtcaggctttcattttggctataaactcactctggacatgaatca
aaccctaaattatccagaatttttataaatgaacttgaccctatgaaagctgtcatttga
aacttttgaccatgtgggaaatttctgacaattgtttgtactaacttcatgttttagaac

 2.19 Intr + 135329 135419   91  1  1   52  109    77 0.927   4.85
tcattaccaacccccaatcttctcttttcttctcaaggatttctctgtgagcctttgcaa
gacagtgcattgataatgcccagttgtggttactgcacttcactgtggtggttattagag
agacaatgtcaaacatgatttttcttgtattgaaactgatttttaattattatttgttag
AATACTCTAAGGAACCCTTTTGTGCAAGTTTTTGTAAAGTTCTCCGTGGGACTCGATGCT
GTTGAACTATTGAAACAGATAGATGAACTCG
gtgagtccaaattcacaaagcttttattcatgagtcatgtcggacatataaacaacattg
ttccatatgattacattttccccccttttctcctgtacttagtttgtagctagctactca
aagaaaaatgagaccctggatatatcccccctatcttcttcccagttagttgtacaatta

 2.20 Intr + 137891 138070  180  0  0   95  100   161 0.994  16.92
aatatttgcataacgacccattttctttggtgtagaatactagatatttttagagtaaat
tctgcaggcttttgttatttataatctagtttagtatttacaaaaaatcagtatttcatc
taattacgaccagaatcaggaccataatttttttttgtctcttttgctttgcctctttag
ATATTCTAAGACTGAAATTAGAGAACAACATTGACATCATCGATCAGCTTAACACACTAT
CTTCCCTGACAGTAAATATTTCCTCTTGTGTATTATATGACCGTATTCAGGCAGCAAAAA
CCATAGATGAAATGGAGAGAGAGGCTAAAAGGCTCTACAAAAGCAACGAACTCTTTGGAA

gtaagtgctgttctattagggtttgagcatctctttgtgctaaaattggccaaattcttt
cctcatgtctttcatccagaactcagaaaactagtgtgggggtccttaggtcctctgatg
tccttagaaaagagaacctttcatgtaggcaaccaactataatctctaagtatgtctaat

 2.21 Intr + 138608 138923  316  0  1  101  108   116 0.991   9.10
ttgaatttctgaggttgacacctccaattaaccatgttttctgtaaattaagaacctgaa
cctactgtcacattactaactcaattgactgtttggctgtcccctctgtgtactctccaa
acaatgaataacgtcaaccataaaataacctttctgctgttgttgccattttatttttag
GTGTTATTTTTAAGCTTCCTTCTAACAGAAGCTGGCACAGAGGCTATGACTCTGGAAATG
TCTTTCTTCCTCCTGTCATAAAATATACCATCCGGATGAGTCTCAAGACCGCACAGACCA
CAAGAAGCCTAAGAACCAAGATTTGGGCTCCAGGGCCACACAATTCTCCATCACACAACC
AGATCTATGGCAGGGCTTTTATTTATTTACAGGATAGTATTGAAAGAGCAATCATTGAAT
TGCAAACTGGAAGGAACTCCCAGGAAATAGCAGTCCAGGTTCAAGCAATTCCTTATCCCT
GCTTCATGAAAGACAA
gtaagtgtgtgcacttccagcctttttaatgatcaacaacttttctgagaactcacttca
gtccattcattcagatgtattacatgaaaggaacaacattcaccaaacttttgtaatatg
cttgttttgagaaagagttcacactatagggcatagcttcatcataactgctcatcaata

 2.22 Intr + 141819 141933  115  0  1   97   87    19 0.845   2.23
gacctatggttaaatcagcttcatgcttcgtaaataatggggtaataccgattattttca
atttcaaaacacgatcataagttcaatgtaagagagagtgagttctttatatattataat
ctctgcaagtatggtgttcattttggtcgctgaatttttctttttttgtttgttttacag
CTTCCTAACCAGTGTCTCTTATTCTCTTCCAATTGTGCTTATGGTTGCCTGGGTTGTATT
TATAGCTGCCTTTGTAAAAAAGCTTGTCTATGAGAAAGACCTCCGGCTTCATGAG
gtatgttgaaaatcacttcttgttatgaataagtcctgttcatagaacaattactatgat
tttcatcatgcctttataaacttcagaaagcctaacttatcccttgtgaattaaacagaa
agaaaaaccttttacaaatcacaaaagcagctgataaggcaatattttattttctcaaaa

 2.23 Intr + 148597 148926  330  0  0   80  115   199 0.832  16.70
ggtgtatataggcatatttcacatagcaagcatggataaattcttgatttatgtaaatta
ttaaaatgcctagttccatatacagagagactatcatgacattttgacataatacaggga
ataatttttatttggaagaatatcagcataacaagcgcctcacattttttcttcttacag
TACATGAAGATGATGGGTGTGAACTCCTGCAGCCATTTCTTTGCCTGGCTTATAGAGAGT
GTTGGATTTTTACTGGTTACCATCGTGATCCTCATCATTATACTCAAGTTTGGCAATATT
CTTCCTAAAACAAATGGGTTCATTTTGTTCCTGTATTTTTCGGACTACAGCTTCTCGGTT
ATTGCCATGAGCTATCTTATCAGTGTCTTCTTCAACAACACCAACATTGCAGCTCTGATC
GGAAGCCTCATCTACATCATTGCCTTCTTTCCATTTATTGTTCTGGTTACAGTGGAGAAT
GAGTTGAGCTATGTATTGAAAGTGTTCATG
gtaagtcaaccgttggaatggcagagtgggaaattacccatttttgtttgtttgtttgtt
tgtttttggattctcagactgaaagttcacttatcttaatttgaaattcagtgaaagcaa
agtaagcttaatgtcctaatgatagcttttcttacatcactgtataccatacaagacaat

 2.24 Intr + 150007 150076   70  0  1   87   74   103 0.997   6.64
tgctcttgcttcacagttgtagcatggttggtaagggactgctgtatttttaaatatgct
tagagaatgagcatcaattttatctatacaaatgtccaaagttttaagtattttaggata
cctctgggtgaaatacatgaaatctacaagaactatcattgccgtttcctttcttcacag
AGCCTGCTGTCCCCAACAGCATTCAGCTATGCAAGCCAATACATTGCACGATACGAAGAA
CAGGGCATTG
gtaggtcccctttctttaaaactggattttatctttcacaactgtgctgtgtgtcacaga
agaataaacacttgtgttcactttttaggtcttcagtgggaaaatatgtacacctccccg
gttcaggatgacaccacctcatttggctggctgtgctgtctaatcctagctgactctttc

 2.25 Intr + 151835 151981  147  0  0   88   63    67 0.830   3.49
caaggaaaaaaagcatcgttttttgctttactatggaaactgagaccaccttttagtttt
atatagtgtcaaaaaataaaactacttcctaaaccatacataggatctactgttttgttt
ctgatgataaatgttaacagtcaactaaaactcactgttcctgatatatttttattccag
GGACATACGGTATGGCAGCTCCCTGGTATTTTCCAATTCTTCCTTCCTATTGGAAGGAGC
GATTTGGGTGTGCAGAGGTGAAGCCTGAGAAGAGCAATGGCCTCATGTTTACTAACATCA
TGATGCAGAACACCAACCCATCTGCCA
gtaagacaagtcggtcaacagcgtgctttgttatgagagaaatgatatgaaattacatga
ctagtagtttcaattatttttttctaaatggcaaaattatcatccttttagtcatggatg
aaaatgtctacacatgcgtctttggactcttatggggattaaattgtggctttttctggg

 2.26 Intr + 152900 153086  187  0  1  106   50    99 0.890   5.73
attcattctgcaaccaagtgaggaggctgaagactataataaatcatttgtttctggatt
ttttattttacttagagggttatatttttatagtcttaaatttttaataaagataaagtc
taactctagctgcattaccttacttgtgagtttacaactcttcccttgatttctctccag
GTCCTGAATACATGTTTTCCTCTAACATCGAGCCTGAACCTAAAGATCTCACAGTCGGGG
TTGCCCTGCATGGGGTCACAAAGATCTATGGCTCAAAAGTTGCTGTTGATAACCTCAATC
TGAACTTTTATGAAGGGCATATTACTTCATTGCTGGGGCCCAATGGAGCTGGGAAAACTA
CTACCAT
gtatgttaactttttgacatttattgccatggaagcatgttacaaaaaatacaggtgtaa
aaaaaataaactaacctatgtttataaaacataaagttattacatttcccagatggagga
agatggttcaacttgtatgctatagaatggagtcaaaatcaaaggttgtaatactttaaa

 2.27 Intr + 157245 157441  197  0  2   30   64   129 0.287   2.84
aattttgtatccaggtgataaataatagaaaactatattatgaatcctcaagagtttatt
gtaccttactgagcacataatagttacctagtgaatacatatcaattagggttattgtat
gtttccagtactcaaatagtatatctgtaaaaaaataaccatcatacattatttttgaag
GACTTTAAAAGATACTGGACTATATAGCCATCGTCATAAGAGAGTTGGAACACTGTCAGG
AGGCATGAAGAGGAAGTTATCTATATCCATAGCTCTCATTGGTGGATCAAGGGTAGTAAT
TTTGGATGAACCATCTACTGGAGTTGACCCATGTTCTCGCCGAAGTATATGGGATGTTAT
ATCCAAGAACAAAACTG
gtatgagtagtttctcagaacttctccacccaacagtcatacttctgccctctggcatat
acaaaagcaaactgaggctgggtgcagtggctcacgcctataatcccagcactttgggag
gccaagacaggaggattgcttgagcctgggagtttgagaccagcctgggtaacatagtga

 2.28 Intr + 158985 159145  161  1  2   61   97   135 0.992  10.49
cctggccctgaatttttcttgcatcattttggaagctctttgaggtcagtcagtttttca
gttagctcatgaaatgtgactcttctcagatgtcacaggatttactctggccaactctgt
gtgtcttgggaactgtactttcacgtttcattccctgttgttcttgtctgtattttcaag
CCAGAACAATCATTCTGTCAACGCACCACTTGGACGAGGCTGAAGTGCTGAGTGACCGCA
TCGCCTTCCTGGAGCAGGGTGGGCTTAGGTGCTGTGGGTCCCCATTTTACCTCAAGGAAG
CCTTTGGCGATGGGTATCACCTCACGCTTACCAAGAAGAAG
gtaggaatgggagaaaatatatctcattatggcaccataaattaagttttatatgaaata
ggagcagagtctctccaactttattcattgctaaaattcattagtatactagcttactgc
ttctcatatttgagtgagcatcgaaatcctggaggtcttgactaaaacccagagttctgg

 2.29 Intr + 160588 160824  237  0  0   70   59   279 0.986  20.09
agaatggggccagtagaatagggacccaagtggcaaaggggtctctagagcagtgatgtt
atgatctgactcaggtgtggagtggcctaaaagagctcatcacctcaccctctgattagg
gcctggagcactatagtgtaaagagaggagagtgttttaattcctacttttctctcttag
AGTCCAAATTTAAATGCAAATGCAGTATGTGACACCATGGCCGTGACAGCAATGATCCAA
TCACATCTCCCCGAAGCCTACCTCAAGGAGGATATTGGGGGAGAGCTTGTTTATGTACTT
CCTCCATTCAGCACCAAAGTCTCAGGGGCCTACCTGTCACTCCTACGGGCACTCGACAAT
GGCATGGGTGACCTCAACATCGGGTGCTACGGCATTTCAGATACCACCGTGGAGGAG
gtatacctcaatatttcttttttttcttcaagctgatataacttgctgttccctttgaag
aaatatgtgccatttttctaaaaaaatttttaaaatagttcacaaaattagaaaagctta
acattttttcagtactattcttatgtaagactgagaataaaatgttgccccagctagaca

 2.30 Intr + 161162 161312  151  1  1  127   60    67 0.999   6.61
taaaatgttgccccagctagacagcacgtatcttttacatacagaaatattcacttgaag
tcagacgggaaaaatttgtctcagtaaatgtgataaaagttcaaaatcaaaggtaagctt
agaaatgagaaaagacatgcacttttcatgttaatgaagtgatctggcttctctttctag
GTCTTTCTGAACTTGACCAAAGAGTCACAAAAAAATAGTGCTATGAGTCTTGAGCACTTA
ACACAAAAGAAAATTGGGAATTCCAATGCCAATGGCATCTCAACTCCTGACGATTTATCT
GTGAGCAGCAGCAATTTCACAGACAGAGATG
gtatgaatctaatgtggatattttgtttaattccaatggatgacataaatgagaaaaatc
acagacagactttgatttttaaaaattcaactctaaagtttcattctaaattcaaaaaac
actaaggaaatttaagcctccttttttaagatataaaatattcattaaaccaaatcgaat

 2.31 Intr + 163591 163843  253  2  1   64   85   180 0.942  10.87
gttttcccaatggaaggtccaaggctaaggctgagaaataacattgctgaacctcaaatc
caaatctttaaaagcttttcccaccacagtgtattataccatttatatatagtttctgaa
gttattttattgcttatcaagatttcccagaaccatatccaatctctttttcttaatcag
ACAAAATCCTGACAAGAGGAGAGAGGCTGGATGGCTTTGGACTGTTGCTGAAGAAGATCA
TGGCTATACTCATCAAGAGGTTCCACCACACCCGCAGGAACTGGAAAGGTCTCATTGCTC
AGGTTATCCTCCCCATCGTCTTTGTTACCACTGCCATGGGCCTTGGCACACTGAGAAATT
CCAGCAACAGTTATCCAGAGATTCAGATCTCCCCCTCTCTTTATGGTACCTCCGAACAGA
CAGCCTTCTATGC
gtaagtttctttctgttaactaaaagaatgtttccaaaatgcttccaggagtgtggttgt
acctgaatgaaggccatgagatctggagaataaagtacttagaagccatggtacctgatt
ctgctaaaggaatgaacagtttgattgattgcaatatgttacttctattgccaacaaata

 2.32 Intr + 164764 164850   87  1  0   58   84    57 0.545   0.47
tgcattgagccgtgtgattgcactactgcactccagcctgggcaacacggcaagactctg
tctcaaaaaagaaaaagaaaacccttctatatacagcacatttcatttcttcaagcatga
ttttaatatgggagactagtagaaaaatcatgaatttgtttctgtcctttcatattgcag
TAATTATCACCCGAGCACGGAAGCACTTGTCTCAGCAATGTGGGACTTCCCTGGAATTGA
CAACATGTGTCTGAACACCAGTGATCT
gtaagtggttcttgctcttctattttttgttttcagcattccagtttgagtgtgtgcatg
tgtatgtgggtgtgtgtgtctgttatttgcctggaagaaagctgtaccctgatagaaatc
cctgtttaacagattttgtctatctcctttagttcatttcttagttatcctatgctatac

 2.33 Intr + 165586 165679   94  1  1   70  110    48 0.718   4.25
acaaaacgtcaaatcatttggaaatggtggagcaatgtacactgaagttatgaaaaatca
gtaaattgttctgtgactacacacatgaacttaataccaaatacttgtttacatgctcat
atgtaaacatgagaacacatatacatacacacctcacagcaatatcattttaacttgcag
ACAGTGTTTAAACAAAGACAGTCTGGAAAAATGGAACACCAGTGGAGAACCCATCACTAA
TTTTGGTGTTTGCTCCTGCTCAGAAAATGTCCAG
gtaagatggaattcagtttcagtgaaatgggaaaaatacgggaataaatatcgaaagctc
gaaagatctctctaggttaccaaagaatcagtataagttcattttatggaagctagtagc
tcagaaatatggatctgggcagctcaaaaaatactgactttgaacatcagcttactgttt

 2.34 Intr + 169228 169355  128  0  2   83   93     3 0.259  -1.14
atttcttggtgtaggtgagatgacttctttttcaaagctctttagagtcaaaggacagtc
ttatcacactctaccagttgcagtaatagacaaatcatgagactgaagctccttgacatt
gtctatttaacttgcacagcattggccagaaaaaaattcatttttaactttattttccag
GAATGTCCTAAATTTAACTATTCCCCACCGCACAGAAGAACTTACTCATCCCAGGTAATT
TATAACCTCACTGGGCAACGAGTGGAAAATTATCTTATATCAACTGCAAATGAGTTTGTC
CAAAAAAG
gtaaaataatctgtttataacatatttaattgcttgctaattttaatggtagctgccttc
taaagagacaatagatacaaatttctattgtttacattttacatggttaaattctcagtt
ttatttaaacagccttatatattgaaatgtaaataatgactctaaattaagatttatttg

 2.35 Intr + 170821 170908   88  1  1   50   94    53 0.299   1.15
actgaaatatgataaaaagaattgatagaaatgtaaaatatttgtcaggaagtattcatt
ttatactgtaaatgtgttcctaacagaaacaaaaagttgagctcctcgttaagtatttta
gatctatttaagaagattttctccactaaaccaaagatatatttttattactctctgtag
ATATGGAGGTTGGAGTTTTGGGCTGCCTTTGACAAAAGACCTTCGTTTTGATATAACAGG
AGTCCCTGCCAATAGAACACTTGCCAAG
gtaaattttgatcttttttctggaatgttatacaaatgagaaggtgaaattgatatgttt
aatcattttcatgaagtgaaaacaaaatatgggtacaatcgatttggcattgtgcataac
ccagggcacagtggttccaattctgtgtatgtaccctagggaagcatgtacacattagca

 2.36 Intr + 172675 172874  200  0  2   55   68    92 0.016   1.13
ggaaatttataggcctatggtcagtactctagagaacagtgcataatcttccaagataaa
ataaattattggaaaattgatgctcttattttaaatataaataagatagctgtcagatgt
taagacagcctaatttatttgaatgcaatattgatcttgccttcttttggaatttaatag
GTATGGTATGATCCAGAAGGCTATCACTCCCTTCCAGCTTACCTCAACAGCCTGAATAAT
TTCCTTCTGCGAGTTAACATGTCAAAATACGATGCTGCCCGACATGGTAAAGTTACTAAC
ACAAAAGTGTCCTGTATTGCAACTTCTGTTACTCTTTGTATAAAAATGCACTTTATATCC
TGTTTCTTCACAGGTGGCAG
gtattttatggtatctaaatcacaggtctttaaaaggagtttagaagtagtaactatcgc
cagatgcaacattctggataatcctcttaacttcaggtcaatttagttttctcatctatc
aaatcaggataataatgctgacgtcacgtgcatgtctgctgtcaaccaagcagttatagc

 2.37 Intr + 181174 181351  178  1  1   78  101   102 0.917   9.50
attctagggtcatggtagagtcacgttggaaatattatctggctgccttgcaggatgcct
tatttgtgtcacagccaactcttgtactgttttcttgatggttttagttatgaatctttc
tgaaaggaaaagagtttcaaaaacttatgtgtgttttcctctccctattgctcactctag
AATCAGCAGTTTAATCGATATTTTAGTGGCACTGTCTATCTTGATGGGCTACTCTGTCAC
CACCGCCAGCTTTGTCACCTATGTTGTAAGGGAACATCAAACCAAAGCCAAACAGTTGCA
GCACATTTCAGGCATTGGCGTGACATGCTACTGGGTAACAAACTTCATTTATGACATG
gtgagtaacttatgtccttcattgcagggaataaaagatcaatttggatagaagacatca
gttttctattcaagagttatttactctagtttgttcaaattgttatcacaaagacaggaa
ataaagaaaatgacttgagtcaggcttatcttcatccagtggttggaggaaacataacct

 2.38 Intr + 182850 182965  116  2  2   78   94    31 0.998   1.03
aaagtgaaatcaatgtaaaataagttgaatgttagaagcaatgggaacataaataagaat
tcatttcttcaaatttttctaggtcaacttgttgcagttttaaactagatgggttattga
tttttttttttttgaaaaatgcttgtcacgtattaaacattgttttgaatatttccatag
GTTTTCTACTTGGTGCCTGTAGCGTTTTCAATTGGTATCATTGCGATTTTCAAATTACCT
GCATTCTACAGTGAAAACAACCTAGGCGCTGTATCTCTCCTACTTCTCCTGTTTGG
gtaagctgctgattaagcaatgaaagaagaattaatagaattaaatgcccctagacacaa
ataggacttaaatctcattagctaaattacaattgtcttggggtttcatttgacatgagt
gatgactaacaacacattgcacttgctagtccatagactgcaaagtataatacttttgaa

 2.39 Intr + 184267 184426  160  1  1  120  107    50 0.997   9.17
ctggctgattttcatatttttctgtagagacagggttttgccaagttgctcaggctggtc
tcaaactcctgggctcaagtgatccacctgcctcagcctcctaaagtgttaggattacag
gtgtgagccaccatgcctggccgaggcgtaattttaattctttgtgtttttaacctgcag
GTATGCAACATTTTCCTGGATGTACTTGCTGGCTGGGCTCTTCCATGAAACAGGAATGGC
CTTCATCACTTACGTCTGTGTCAACTTGTTTTTTGGCATTAATTCCATTGTTTCCCTGTC
AGTGGTATACTTTCTTTCCAAGGAAAAGCCTAATGATCCG
gtaaggtcccttatttcagtgaatttatcaaaagcttcaacatgttccaggtggaaagat
tttatttattctacataaaaaagaagaatatcatttgattctattaaatttgggagagga
gaaactacagcttttaaaattctttttgggcctcatctaagttaatgcctatcattgtat

 2.40 Intr + 185521 185774  254  0  2  101   99   203 0.999  18.01
aaacatccaccatttagtatactaaatatttgtatgcaaattcagcctatatgggaaata
attgccaatctagataagctttttaggtttcactatttgtctacatccatctagttttaa
atttttgtcagctttttggaaacttaacactgagttttatttttatttctcttatttcag
ACTTTAGAACTTATTTCTGAAACCCTCAAGCGCATTTTCCTGATTTTCCCACAATTCTGT
TTTGGCTACGGTTTGATTGAACTTTCTCAACAACAGTCGGTCCTAGACTTCTTAAAAGCA
TATGGAGTGGAATACCCAAATGAAACCTTTGAGATGAATAAACTAGGTGCAATGTTTGTG
GCTTTGGTTTCTCAGGGCACCATGTTTTTTTCCTTGCGACTCTTAATCAACGAATCCCTG
ATAAAGAAACTCAG
gtaaatataatgaaaacataacgtttgacatctaaaacagaactcaattcaacctattga
gaaagaagtcaatagtctaagcttttccattggtaatatggaaatgtttggctcaaaaac
ttttaaaaaattctagcataattcactatttattttattctagtaagtagttatcaaatc

 2.41 Intr + 188545 188749  205  1  1   67   94   136 0.743  10.38
tacagtgaggagggtctatactgatttaagttatctgagtagcataattcattacaaatg
taaaagaagtctaatgatgactagtacactgttagtgacatgaaaacccatcaaaacatg
tcaaaattgaatgctgtcatttcaaaatcattgacgtaaaatcactgggtccatttttag
GCTTTTCTTCAGAAAATTTAATTCTTCACATGTAAGGGAGACAATAGATGAGGATGAAGA
TGTGCGGGCTGAGAGATTAAGAGTTGAGAGTGGTGCAGCTGAATTTGACTTGGTCCAACT
TTATTGTCTCACAAAGACCTACCAACTTATCCACAAAAAGATTATAGCTGTAAACAACAT
CAGCATTGGGATACCTGCTGGAGAG
gtaagaaactgtgttttgtttctaactgtccttttcattggcatactatgtgacaaatta
aaatcttaattattggccaggtacagtggctcacacctgtaatcttagcactttgggagg
ccgaggtgggtggatcacttgaggtcaagagtttgagaccagcctggccaacatggtgaa

 2.42 Intr + 190479 190588  110  2  2   55   59    79 0.954  -0.14
ggtatccatttgttttaaaaaagaaagttttatcaagagcattacactatccatgaataa
ttccagagatttatttttctcggtaatttatttcacccagggagaagagggagagataca
aaagcaatgtctcattggtttggattaaggcttatatcttctttttctccctcaaaccag
TGTTTTGGGCTTCTTGGAGTGAATGGAGCAGGAAAGACCACTATATTCAAGATGCTGACA
GGAGACATCATTCCTTCAAGTGGAAACATTCTGATCAGAAATAAGACCGG
gtatgaaaaactaatgcttcaatttagcgagtacaacatacttaaatgagaaaaataatt
gaaatgaacatttaatgttattttgtggttatattattcagtccttaggggagaacaaag
ctattaaggtgggtggaaatgtttaaatgtttaaatgtgaatttgatagtgggattattt

 2.43 Intr + 190891 191032  142  1  1   71   81   153 0.694  12.33
attaaggtgggtggaaatgtttaaatgtttaaatgtgaatttgatagtgggattatttta
tccctttttatcaaagtcactgaccaccatgaccaaaatagagctaccttcccagcattt
gggaaccaggagggataaatcttttgaaattcatctgtgtttttgattctctcaattcag
ATCTCTGGGTCACGTTGATTCTCACAGCTCATTAGTTGGCTACTGTCCTCAGGAAGATGC
CTTAGATGACCTGGTAACTGTGGAAGAACATTTGTATTTCTATGCCAGGGTACATGGAAT
TCCAGAAAAGGATATTAAAGAA
gtgagtacaagtgtgaaaaattacttaatttgaaaccattattgtttctacttccatccc
ccaccccaccacacccactgtcccccctgccccaccatttcccctcaaaaccacctggaa
aacattgtcattttccttctggcagtggcaatggcagtgagtccctcttagtttggtcat

 2.44 Intr + 192072 192206  135  2  0   95   99   -11 0.407   0.54
taatccttaagtgattctttgaaaataaaatctatgttgaatttaagtgttttcattttt
ttccagatatattctccatgataacattttcttttcatgagcatcttttttttttccatt
tagtgctttaagggttttggcacaggaaggtcaacctaactccccttttattgcctacag
ACTGTTCATAAACTCCTTAGGAGACTTCACCTGATGCCCTTCAAGGACAGAGCTACCTCT
ATGTGCAGTTATGGCACAAAAAGAAAATTATCCACTGCACTGGCCTTGATAGGGAAACCT
TCCATTCTACTGCTG
gtaagagaatcattatttaaacaggccactccataattagaacagcatatctgattgcat
gtgttaacatttcatcatcatgattgcagtcaacatttattgaggtctcactatgtgcta
gctattgtgcaaagcactttatgtatactatctcaataaaggattttatatcagcaaata

 2.45 Intr + 194524 194627  104  0  2   55   97    59 0.147   1.55
aatgattaattttgaactttttgacagcagcagaaagaagtctattaagtataaaacaag
ttagtcacaggacctcgaaaagtatttctgttctagggaagtgaaatgcagtaattcatg
aaaagaacttcatcaaaaattaattaatttgataaatttttgttgtaactttctattaag
GATGAGCCGAGCTCTGGCATGGATCCGAAGTCGAAACGGCACCTCTGGAAGATCATTTCA
GAAGAAGTACAGAACAAATGTTCCGTCATCCTCACATCTCACAG
gtaaactgagtggaatctttaaagcgaatccacacagtcttaggatgacaggtgggaaaa
ggtaatcctgtataacataaataaatatatacacatacatatatatgtgtgtgtatatat
atatatacacacatacaaaatatatacacacaaatatatgtatatatatagacaacgaat

 2.46 Intr + 196611 196703   93  0  0  103   72    39 0.041   1.96
ccactgcactctagcctgggcaacagagtgacaccctatctcaaaaaaataacaaagaaa
agaaaaaaactaaaatagtatttccaagtgccataatgaaacaattatgcttatgctcat
gaacttcaacccaagttttctgtatcctgaatgctaatatgatcctgctttgtcttttag
CATGGAAGAATGTGAAGCTCTCTGTACCAGGTTGGCCATTATGGTGAATGGAAAGTTTCA
ATGTATTGGATCTTTGCAGCACATAAAGAGCAG
gtgaagaacaaatgcattgcttaacagatagtgttgggtcatctatctaatggtgctcac
tcagattcaaggattatctcagcagcctaagtagtaaaactagaatggacaagctaatct
ttggaagctagtcactgactcaccttaaatttaaattattttattggggatttgatgaat

 2.47 Intr + 202013 202118  106  2  1  115  106    89 0.902  12.70
tagcagtgcactatttccagtttgcaacatgtcctgaacttttatggcaaaatgatagtc
ttcatataaagaaaaggtgatataatggttggcttgggtcctgtttcattatctagaatt
ccagaggagctatttcagcaaaatgtaattcatatcatattttgcactttttctttctag
GTTTGGACGAGGATTTACTGTCAAAGTTCACTTGAAGAATAACAAAGTGACCATGGAGAC
CCTCACAAAGTTCATGCAGCTGCACTTTCCAAAAACATACTTAAAA
gtaagtgatgatggctgggtgcagtggctcacgcctgtaatcccagcactttgggagtcc
gaggcgggcaatcacttgaggtcaggaggttaagaccagcctggccaacatggtgaaacc
ccgtctctacaaaaaatacaaaaattagctgggcatggtggcacatgcctgtaatcccag

 2.48 Intr + 205413 205550  138  2  0  100   94    36 0.905   5.14
aaactttcatctcatctttgcaagctgttagtttcaaaatatactcgttatttatactgt
agcatcattttcagtggaatgaacttcagttattttcctgaactcttggtaaagttatgt
ctagtcatgtcaacattaccagacattgcaaaataaacttttttcctttggttcccacag
GATCAGCACCTCAGCATGCTAGAGTATCATGTACCAGTCACAGCAGGAGGAGTCGCAAAC
ATTTTTGATCTGCTGGAAACCAACAAGACTGCTTTAAATATTACAAATTTCTTAGTGAGT
CAGACCACTCTGGAAGAG
gtaagatatataccacgatccatgtgcacaacgtcacatattaatattattattcattct
ggttatttctttttaattacattcaatttgtttttaattgaattaatatctagtcttgca
cctgaaaaacttagcaaagagcctaatcaatttctcacttaatttggggatattaaaaaa

 2.49 Term + 206854 206994  141  0  0   85   41   133 0.891   5.25
gctgttttcaagccccagttaaatttgattttctgaaaggactcctagtgcaagcatgta
taaaactaggatttggattttataggggcctgcatacacatatatacacgcttgcactag
gagagaggaaggggagagagagagaatgaattaactttattttttcctttggcttaccag
GCATTAATGGCTTTATTTTCCCTGAAAAATCAGGTTTTCATCAACTTTGCCAAAGACCAG
AAGTCCTATGAAACTGCTGATACCAGCAGCCAAGGTTCCACTATAAGTGTTGACTCACAA
GATGACCAGATGGAGTCTTAA
cacttccagcaaactcaatctcagcgtgtgaccaatggcttcattttgaagaaaagccac
agaagatacacttccgcaagatatcttcattttaaagtaaagtaatatactgtatggaaa
gttacaactgtgttagactaacaagtaattataaaaggaaatttttccttctaaggtcag

 3.03 PlyA - 207415 207410    6                               1.05
 3.02 Term - 207604 207538   67  0  1   75   44    73 0.573  -1.97
 3.01 Intr - 209070 208950  121  1  1   45   79   140 0.313   7.43

Predicted peptide sequence(s):


>ABCA12_1|GENSCAN_predicted_peptide_1|140_aa
MRRKQKTNAGNMTKQGSSTPPENHTSSPAMDPNQEEIPDLPDKEFSRGKEVIIRKGTCTH
VYRSTMHIRKALDTCLDLMASHYFHNFGYYSDQISSNCKTNFLFDGWASGEVCIFDEREP
AAIPDTIGAGPDNIDIPDIT

>ABCA12_1|GENSCAN_predicted_peptide_2|2459_aa
MVQEASEAIRQHQSSAANLRRSGKESVRELWASIPGALGVAARVWFRGIPDASPLYSSKP
QHHIGDHSNRRGIKSSTRSLSAGFAEVTLGHIGVEALIPRDWNQEELVYLILSEGYLAPR
NLPSTGFFPFLQTLLCDTDSKCKDTPYGPQDLLRRKGIDDALFKDRMFSSTPGLYSLDAS
DTPRTVVTTKYVSRHCQMSPGVGVLSTLENHWANRRLKEKCFWLQEACIKDVTTVFPSPS
SDLEIPGTYTFNGSQVLARILGLEKLLKQNSTSEDIRRELCDSYSGYIVDDAFSWTFLGR
NVFNKFCLSNMTLLESSLQELNKQFSQLSSDPNNQKIVFQEIVRMLSFFSQVQEQKAVWQ
LLSSFPNVFQNDTSLSNLFDVLRKANSVLLVVQKVYPRFATNEGFRTLQKSVKHLLYTLD
SPAQGDSDNITHVWNEDDGQTLSPSSLAAQLLILENFEDALLNISANSPYIPYLACVRNV
TDSLARGSPENLRLLQSTIRFKKSFLRNGSYEDYFPPVPEVLKSKLSQLRNLTELLCESE
TFSLIEKSCQLSDMSFGSLCEESEFDLQLLEAAELGTEIAASLLYHDNVISKKVRDLLTG
DPSKINLNMDQFLEQALQMNYLENITQLIPIIEAMLHVNNSADASEKPGQLLEMFKNVEE
LKEDLRRTTGMSNRTIDKLLAIPIPDNRAEIISQVFWLHSCDTNITTPKLEDAMKEFCNL
SLSERSRQSYLIGLTLLHYLNIYNFTYKASVFPEERSKASRKDDGALHKTKRDSQSDGFW
HTSAARQNEIPEANASAQKCSINTGCFFNSKVKCVVGENEKLNTLRNPFVQVFVKFSVGL
DAVELLKQIDELDILRLKLENNIDIIDQLNTLSSLTVNISSCVLYDRIQAAKTIDEMERE
AKRLYKSNELFGSVIFKLPSNRSWHRGYDSGNVFLPPVIKYTIRMSLKTAQTTRSLRTKI
WAPGPHNSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEIAVQVQAIPYPCFMKDNFL
TSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESVGFL
LVTIVILIIILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLI
YIIAFFPFIVLVTVENELSYVLKVFMSLLSPTAFSYASQYIARYEEQGIGTYGMAAPWYF
PILPSYWKERFGCAEVKPEKSNGLMFTNIMMQNTNPSASPEYMFSSNIEPEPKDLTVGVA
LHGVTKIYGSKVAVDNLNLNFYEGHITSLLGPNGAGKTTTMTLKDTGLYSHRHKRVGTLS
GGMKRKLSISIALIGGSRVVILDEPSTGVDPCSRRSIWDVISKNKTARTIILSTHHLDEA
EVLSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNLNANAVCDTMAVTAMIQ
SHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEV
FLNLTKESQKNSAMSLEHLTQKKIGNSNANGISTPDDLSVSSSNFTDRDDKILTRGERLD
GFGLLLKKIMAILIKRFHHTRRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQIS
PSLYGTSEQTAFYANYHPSTEALVSAMWDFPGIDNMCLNTSDLQCLNKDSLEKWNTSGEP
ITNFGVCSCSENVQECPKFNYSPPHRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGG
WSFGLPLTKDLRFDITGVPANRTLAKVWYDPEGYHSLPAYLNSLNNFLLRVNMSKYDAAR
HGKVTNTKVSCIATSVTLCIKMHFISCFFTGGRISSLIDILVALSILMGYSVTTASFVTY
VVREHQTKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGIIAIFKLPAFYSENNL
GAVSLLLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEK
PNDPTLELISETLKRIFLIFPQFCFGYGLIELSQQQSVLDFLKAYGVEYPNETFEMNKLG
AMFVALVSQGTMFFSLRLLINESLIKKLRLFFRKFNSSHVRETIDEDEDVRAERLRVESG
AAEFDLVQLYCLTKTYQLIHKKIIAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDI
IPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIK
ETVHKLLRRLHLMPFKDRATSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKRH
LWKIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVK
VHLKNNKVTMETLTKFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVANIFDLLETNKTALN
ITNFLVSQTTLEEALMALFSLKNQVFINFAKDQKSYETADTSSQGSTISVDSQDDQMES

>ABCA12_1|GENSCAN_predicted_peptide_3|62_aa
XINISSFQSPQDTQSHRAFVSVSDFNEDSVVTGTIHSMAAHPYGKALFFGFSTSPCIHRY
RK