GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:52:03

Sequence ZNF432_1 : 19582 bp : 40.85% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    853   1021  169  1  1   29  100   241 0.634  18.43
tgttccgtgtctgttcagaggactttacccccacgccgtgtctgcctgtgtgaactcaag
cctctgataagctctccattttctgccagggctgaggtgtctggaaatcggacagtttaa
gaggcctccgtccaccgcgtctcccggccgctgtgccttctgtacgtcacgtactcaaag
ATGGCCGCCCCCAGAGCGGCGAGGCGACGCCGGCGCGGACGCGTCTCCTCCTGAGGAAAA
GCCGGAAGGCCGCATTCCGCTCTCCATGGAAACGCGGCTGACCGTCTCTGGAGGTTTAGA
GGGGGAGGGAGTTGGGCGAGGGGCCCAGAAGTGGAAGAAGTTTAGGGAA
gtaagttcagcttttaagaggtcgcggcgattccaaggagagtcaggtcagtgtgtgggt
cagggcgtggaaacgtggtgggagggagctttctgagggcgtctgcgttgttggtggcgc
tatatggtggaggtagcgcgggggttgggggaggcgggggcgggtgtttccttttggagg

 1.02 Intr +   8156   8282  127  1  1   85   68   146 0.540  11.63
tggggcactgtgcaattatagaatacttggagattctctggcaatattaaaaaatacaat
agacttatagatggatgcagtctatatgtttaatgtgagcgggacaacttcccttcactt
tcttttcatgtcagtaaaagagaaacacttcctattaagcaaggctctgttttcttacag
GAATTGCTGACACTGGAGGATGTTACTGTGGAGTTCACCTGGGAGGAGTGGCAGCTCCTG
GGCCCTTTTCAGAAGGATTTGTACCGGGATGTGATGTTGGAGATCTACAGCAACCTGCTA
TCAATGG
gtgaggacagctgctctgtgtcacctggagggtgcccagtctgtggcctttgctttctca
gttgcttacccttggaagttactgcagtgctctgaatattagatttttggcacatcctct
ggcttctgataaaaggatataccgtcacccctcagtgtccaagagggattggtttcacaa

 1.03 Intr +   9179   9274   96  0  0   74   91   156 0.994  13.56
tgaatccctggatgtgaaattttcagatattaaggtctgactgtaatctgccctttcctg
agagagaagcctctactttcagatgtgaaaactgtctagttacttaaatgtaacattctc
tcacattacataccccagcccaatccagtgtgtctgtcttctattatttcccgtaaacag
GTTATCAAGTCAGCAAACCAGATGCACTCTCCAAGTTGGAACGAGGAGAAGAACCATGGA
CAATGGAAGATGAAAGGCACAGTCGAATCTGTCCAG
gtatgtgagaagcagcaagatgcgtaagtaatattatagtcagtgaaagaaggctctgtg
ggtgtctgaggacacagaagcagtgcctacattaggaatgggaatcgttttccctccaca
agaaacccttcccatcttattttaaggttgcattctcctttagtaccatacatctgtcct

 1.04 Term +  14322  16042 1721  1  2   79   48  1534 0.991 135.71
gcggaggttgcagtgagctgagatcataccactgcactccagcctgggtaacagagcgag
actctgtctcaaaaaataataataataaacaaaataaaacaccaaggatttttttttcta
agaagacagttttatccccaacaagattataaaaggattcattgttctcttctttcctag
AAAACAACGAAGTTGATGATCATCTGCAGGATCACTTGGAAAATCAAAGGATGCTGAAGA
GTGTGGAACAATACCATGAACATAATGCATTTGGAAATACTGCCTCTCAAACCAAAAGCC
TTTGTCTTTTCAGGGAAAATCATGATACATTTGAGTTATATATAAAAACTTTGAAATCAA
ATTTAAGTTTAGTCAACCAGAACAAAAGCTGTGAAATTAACAACTCTACTAAATTTAGTG
GAGATGGGAAATCATTTCTTCATGGTAACTATGAAGAACTTTATTCTGCAGCTAAATTCT
CTGTAAGTACAAAAGCCAATAGCACTAAATCCCAAGTCAGTAAGCATCAGAGAACTCATG
AAATAGAAAAAAACCACGTATGCAGTGAATGTGGGAAAGCGTTTGTCAAGAAGTCTCAGC
TCACTGATCATGAGAGAGTTCATACAGGAGAAAAACCTTATGGATGTACTTTGTGTGCAA
AAGTGTTCTCCAGAAAGTCCAGGCTAAATGAACATCAAAGAATTCATAAAAGAGAGAAAT
CTTTTATATGCAGTGAATGTGGAAAAGTCTTCACTATGAAGAGCCGTCTGATTGAACATC
AGCGAACTCATACTGGAGAGAAACCCTACATATGCAATGAATGTGGAAAAGGCTTCCCAG
GCAAGCGTAATCTCATTGTACATCAGCGAAATCATACTGGAGAGAAATCCTATATATGTA
GTGAATGTGGAAAAGGCTTCACTGGGAAGAGCATGCTTATTATACATCAGCGAACTCATA
CAGGAGAGAAGCCCTACATCTGTAGTGAATGTGGGAAAGGCTTCACCACAAAACACTATG
TCATCATACATCAACGAAATCATACAGGAGAGAAACCATATATATGCAATGAATGTGGGA
AAGGCTTCACCATGAAGAGCCGTATGATCGAACATCAACGAACTCATACAGGAGAGAAAC
CCTACATATGCAGTGAATGTGGAAAAGGCTTTCCCAGGAAGAGTAATCTTATTGTACATC
AGAGAAATCATACAGTAGAGAAGTCATATCTATGTAGTGAATGTGGAAAAGGTTTTACTG
TGAAAAGCATGCTCATCATACATCAGCGAACTCATACAGGAGAGAAGCCCTACACATGCA
GTGAATGTGGGAAAGGCTTCCCCTTGAAGAGTCGGCTGATTGTACATCAGCGAACTCATA
CTGGAGAGAAACCTTACAGGTGCAGTGAATGTGGGAAAGGTTTCATTGTGAATAGCGGAC
TGATGTTACATCAGCGAACTCATACTGGAGAGAAACCGTACATATGCAATGAATGTGGAA
AAGGTTTTGCCTTTAAGAGCAATCTTGTTGTACACCAGCGAACTCATACTGGAGAGAAAC
CCTTTATGTGCAGTGAATGTGGAAAAGGCTTCACCATGAAACGCTATCTCATTGTACATC
AGCAAATTCATACAGAAGAGAAATCTTGTATATGTAGTGAATGTGGAAGAGGCTTTGCCA
AGGAAACAGAGCTTGCTTTACATAAGCAAGTTCATACTGGAGAAAAACCTTATGGATGTA
ATGAATGTGGTAAAGGCTTCACTATGAAGAGCCGTCTAATTGTTCATCAACGAACTCATA
CAGGAGAGAAACCCTTTGTATGCAGTGAATGTAGAAAAGCCTTCTCCTCAAAGAGAAATC
TCATTGTACATCAGCGAACTCATAATGGAAACAAACCCTGA
caatgcagtggacatgttcatgcctttgggaagaaaatctgccttgtacaacatcagaga
tttcacagtatagattttctacatgtgtactgagtatgaaaaatcatatttcaaaatcca
gtgttattcactaggatgaatgctatcaatgtcagaaaggcttcaacatgaattcaggct

Predicted peptide sequence(s):


>ZNF432_1|GENSCAN_predicted_peptide_1|704_aa
XWPPPERRGDAGADASPPEEKPEGRIPLSMETRLTVSGGLEGEGVGRGAQKWKKFREELL
TLEDVTVEFTWEEWQLLGPFQKDLYRDVMLEIYSNLLSMGYQVSKPDALSKLERGEEPWT
MEDERHSRICPENNEVDDHLQDHLENQRMLKSVEQYHEHNAFGNTASQTKSLCLFRENHD
TFELYIKTLKSNLSLVNQNKSCEINNSTKFSGDGKSFLHGNYEELYSAAKFSVSTKANST
KSQVSKHQRTHEIEKNHVCSECGKAFVKKSQLTDHERVHTGEKPYGCTLCAKVFSRKSRL
NEHQRIHKREKSFICSECGKVFTMKSRLIEHQRTHTGEKPYICNECGKGFPGKRNLIVHQ
RNHTGEKSYICSECGKGFTGKSMLIIHQRTHTGEKPYICSECGKGFTTKHYVIIHQRNHT
GEKPYICNECGKGFTMKSRMIEHQRTHTGEKPYICSECGKGFPRKSNLIVHQRNHTVEKS
YLCSECGKGFTVKSMLIIHQRTHTGEKPYTCSECGKGFPLKSRLIVHQRTHTGEKPYRCS
ECGKGFIVNSGLMLHQRTHTGEKPYICNECGKGFAFKSNLVVHQRTHTGEKPFMCSECGK
GFTMKRYLIVHQQIHTEEKSCICSECGRGFAKETELALHKQVHTGEKPYGCNECGKGFTM
KSRLIVHQRTHTGEKPFVCSECRKAFSSKRNLIVHQRTHNGNKP