GENSCAN 1.0	Date run: 15-Jan-104	Time: 19:16:39

Sequence WDR18_1 : 12635 bp : 62.39% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1234   1443  210  0  0  110   86   384 0.822  39.35
cctcgagtctcaggtaagcgggaaatcccacttcacaagaaagcccctctctccgaggca
cgggcgcatgcgcgggtcggccacccgctggggccgcggggccgccgctctggcccgcgt
ggggcagtcgtccgcgtctcgctcatgatgacgcacgtccggggcggtggggaaggcaag
ATGGCGGCGCCCATGGAGGTGGCCGTGTGTACGGACTCGGCGGCCCCGATGTGGAGCTGC
ATCGTGTGGGAACTTCACTCGGGCGCCAACCTGCTCACCTACCGCGGCGGCCAGGCGGGA
CCCCGCGGCCTGGCGCTGCTCAATGGCGAGTATCTGCTGGCGGCGCAGCTGGGCAAGAAT
TACATCAGCGCCTGGGAGCTCCAGCGGAAG
gtgcggcggtgcggtctcgctgctggggtcatggggcgcccgaggctgaagtcgggggat
gggttggtgggggccgcgtgcacccttagtcggaattggcgtggggaggggaggtggtct
ccgttcgggcgctctgcgcatgcgcgggtctgggggctttggggagatacgtgcgacctg

 1.02 Intr +   2745   2855  111  2  0   61   94    52 0.912   4.84
cttgcaggggcgaacacttccttgctggaccatgcatttgctcaaaccaccctgctcccg
actcctcttcctggttctctgacttagccattgcccaggcgtcccctcccctcgccctcc
actgctgtagtagctcccgtgtcctgcatggggctcacgaggctgactgtgcatccttag
GACCAGCTCCAGCAGAAGATCATGTGCCCCGGGCCTGTCACCTGTCTGACTGCATCACCC
AATGGTCTCTACGTCCTGGCAGGAGTTGCAGAAAGCATCCACCTGTGGGAG
gtaagaggagcaaagcgtgagcgtttcccacaggacatctcagcccatctgagctttgcc
tgcagggcaccagggaacaaccatgcggcctggggccctgggatgggtgactgctcaggg
gttatagcctaagcttcaccctgctgcctcctttctccaggtcccctcgagacttgcgaa

 1.03 Intr +   6642   6775  134  2  2  143   74   146 0.999  19.32
aggccccgctgtacctgctggccgctgccctgacagggtcaccccgcagtcctggggcag
ggcaggcagggggcgacagtgtggccatggccgtgcagtggtgggttcctggggctgcag
cccccctttcctcccctggggctttcctcccctgacctggataccctctgcccctcacag
GTCTCCACCGGGAACCTTCTGGTCATCCTGAGTCGACACTACCAGGACGTCTCCTGCCTT
CAGTTCACAGGGGACAGCAGCCACTTCATCTCAGGGGGCAAGGACTGCCTGGTGCTGGTT
TGGAGCCTCTGCAG
gtagcgccttgcgcactcaggcctgcacctggaactgcacccgggctcaggcggggagag
gaggcgccaaggcccctggcgggaaggggcttctctcttgggggctggagtgcagaggac
ggagtgatcatcccaggggtcctggctgcccacactggggtctggtttgttctgggggcc

 1.04 Intr +   7103   7244  142  2  1   72  107   136 0.950  15.44
gcccacactggggtctggtttgttctgggggccgtgggggcccagccttgagtttactca
ggtgaggcaggccaggctgctgagtggaggcaggtgtgtgcgtgaggtgggtgctggagg
cgtggactgccctgttccctccgctccccgcctgctgagcacctgccccaccccgctcag
CGTGCTGCAGGCCGACCCCTCCAGGATTCCGGCGCCCAGGCACGTCTGGTCTCACCACGC
GCTCCCCATCACGGACCTGCACTGCGGCTTTGGGGGCCCCCTGGCCCGGGTGGCCACCTC
CTCACTGGACCAGACGGTGAAG
gtacgccgcccccaccccaccacggtccatgagcggagcccagcagccgcaggtcctcag
ccaggaatgcaggaatcgcctcctcccgctccctgctgtcaggactccagacggctttta
atcccctggtgctctgagcccaaggacgtccagggaggtctgccagcctggaaattccta

 1.05 Intr +   7732   7875  144  0  0   93   92   217 0.974  24.26
atttcagcacaggccatgtcccctggcccccaagacccacatggtgacggctttcaccca
aagtcgcaagccctagggccagaggacagccgacgcctgacctccctggtgcccctgttc
ccatggggtcctcgggttccccctgccgggccgagccccacgccctttgcccacccgcag
CTATGGGAGGTCTCCTCGGGGGAGCTGCTGCTCTCCGTCCTCTTTGACGTGTCCATCATG
GCAGTGACCATGGACCTGGCTGAGCACCATATGTTCTGCGGGGGCAGTGAGGGCTCCATC
TTCCAGGTCGACCTCTTCACCTGG
gtgagtgccgcggtctgcgggctgcaccctgccctggggctgagggcatcgggcctgcgg
ctcacacacgtctcggccttcgcagcccggacagagggagaggagcttccacccagagca
ggacgccgggaaggtcttcaaagggcacaggtggggacgtgggaacggggcgggggctcc

 1.06 Intr +   7961   8025   65  1  2   81   75    38 0.958   0.46
tgtccatcatggcagtgaccatggacctggctgagcaccatatgttctgcgggggcagtg
agggctccatcttccaggtcgacctcttcacctgggtgagtgccgcggtctgcgggctgc
accctgccctggggctgagggcatcgggcctgcggctcacacacgtctcggccttcgcag
CCCGGACAGAGGGAGAGGAGCTTCCACCCAGAGCAGGACGCCGGGAAGGTCTTCAAAGGG
CACAG
gtggggacgtgggaacggggcgggggctcccaggcacgtcctgtctggcacgtcccaggt
gacccctgtctgtctgtccaggaaccaggtgacttgcctgtcagtgtccactgacggcag
cgtgctgctctcaggctcccacgacgagaccgtgcgcctctgggacgtgcagagcaagca

 1.07 Intr +   8107   8231  125  1  2   86   86   225 0.962  23.50
ggcctgcggctcacacacgtctcggccttcgcagcccggacagagggagaggagcttcca
cccagagcaggacgccgggaaggtcttcaaagggcacaggtggggacgtgggaacggggc
gggggctcccaggcacgtcctgtctggcacgtcccaggtgacccctgtctgtctgtccag
GAACCAGGTGACTTGCCTGTCAGTGTCCACTGACGGCAGCGTGCTGCTCTCAGGCTCCCA
CGACGAGACCGTGCGCCTCTGGGACGTGCAGAGCAAGCAGTGCATCCGGACGGTGGCCCT
CAAAG
gtgggcgcgcctctgctcggcccgcggccagcgcgcaggggaaaaagccagcaggagctc
cgggcttggcttgggtgggggcggggactggtttgctgtggggcggggccgggctggggg
cgtggactggctgtggggcggggcctggctgggggagtggactggctgtggggcgtgggc

 1.08 Intr +   8835   9001  167  1  2   77   96   269 0.985  27.48
gggtggggcctggctgggggcgtggactggtcgtggggcggggcctggctgggggcgtgg
actggctgtggggcggggactggctgggggcggggactgccctggatggggcggaacttg
gcttgctgtggggtggggcctggctgggatggggcggggcctgacctccgcgccccccag
GCCCAGTCACCAATGCCGCCATCCTGCTGGCGCCCGTCAGCATGCTGAGCTCAGACTTCA
GGCCCAGCCTGCCGCTGCCCCACTTCAACAAGCACCTGCTGGGCGCCGAGCACGGGGACG
AGCCGCGCCACGGGGGCCTCACTCTGCGCCTGGGCCTCCACCAGCAG
gtacggcccccagcagggaacccccactgcccttttgtcccggaagaccccgcgggccct
gggctccttcgctcccttggtcctggcgcccgtgcggcggttccccacaagcccggcact
ggagggcgcgtcctgtgagtgggatggtgatgctcggtggggcctctgcccactctcagt

 1.09 Intr +   9048   9135   88  2  1   46   76    70 0.592   2.30
ccgtcagcatgctgagctcagacttcaggcccagcctgccgctgccccacttcaacaagc
acctgctgggcgccgagcacggggacgagccgcgccacgggggcctcactctgcgcctgg
gcctccaccagcaggtacggcccccagcagggaacccccactgcccttttgtcccggaag
ACCCCGCGGGCCCTGGGCTCCTTCGCTCCCTTGGTCCTGGCGCCCGTGCGGCGGTTCCCC
ACAAGCCCGGCACTGGAGGGCGCGTCCT
gtgagtgggatggtgatgctcggtggggcctctgcccactctcagtatggacccagaggc
tctgagaagttaaccacccctcttcccccggccagcagggccgagctgcacgccccacac
accagccttcctgcggctggatatctgacagtcagttaggtctttctgcaaaaggccgat

 1.10 Intr +   9487   9513   27  2  0  104   79    11 0.431   1.01
aaggccgatgccccatacttcgggctgtgagagccaaaaggttcacgtctgggctgccga
aggtgcaggagcagccgtgagggcagggagcgggtggggccctggtggctgcaggtggct
cccacgtgggctgggggcagcctctcggcctggccacagtcacgccctcactccctgcag
CTCAGCACCGACCCCCGCTCTGTGCAG
gtactagggtgggctcccttaccttctgagggtagagtgacttccggaacacttcccacc
ccagccccaagaccctcatagaagccagtgtggttggctgggctgggctggggtgggggc
tgggggttccttgggcctggggaggcttcccagtgtgtttccgcctcactccccgacctt

 1.11 Intr +  10599  10711  113  1  2   73   32    92 0.510   3.37
gcgggttcccgacctctgatcccccagcaacgtccctccatgtaactggttcctctgtac
agggcagtggccttgctgggccggccaggctctccccatggctggaggtgctcactgtct
gtgaggccctcgccaggccctgtgtcccagagccttccctgggcttgcgggtccttccag
GTCTGGCCCAGGCCCCTGTCTGTGGTGTGGCCATCTGCACCCCCATCCCCAGCCACATCC
TTGGGCGCAGTCGTGGAGGATCTGAGGCGCTGGGTAATGACTGCATGGCCAGG
gtcagggttgtcatctgcaggctcgacggaggtgaacgcccccgtctcagtcttcccttc
tgtctgtgggcgtcacggtggcccctccctggctgagtggctgcccacgctggcgggggt
gggatgggcaaagcgtgtggtgtgtgacaggacgcgccccgaggtcacgtggctccctgt

 1.12 Intr +  10899  10967   69  2  0   65   86   142 0.952  12.23
ttgtcatctgcaggctcgacggaggtgaacgcccccgtctcagtcttcccttctgtctgt
gggcgtcacggtggcccctccctggctgagtggctgcccacgctggcgggggtgggatgg
gcaaagcgtgtggtgtgtgacaggacgcgccccgaggtcacgtggctccctgtgttacag
GGCTCGGAGCCCAGCTACCTGGACCGCACGGAGCAGCTGCAGGCCGTCCTGTGCAGCACC
ATGGAGAAG
gtgggcggggcctcgggaggggcggggcctgaggctggggtcagtcctggccagtggggg
tgagtggcccccctccagcacaccccaggccacttctgccctctgaccccgacttctccc
gcagagcgtgctcggcggccaggaccagctgcgcgtccgtgtgacggagctggaggacga

 1.13 Intr +  11092  11219  128  0  2  118   61   334 0.557  34.35
gctacctggaccgcacggagcagctgcaggccgtcctgtgcagcaccatggagaaggtgg
gcggggcctcgggaggggcggggcctgaggctggggtcagtcctggccagtgggggtgag
tggcccccctccagcacaccccaggccacttctgccctctgaccccgacttctcccgcag
AGCGTGCTCGGCGGCCAGGACCAGCTGCGCGTCCGTGTGACGGAGCTGGAGGACGAGGTG
CGCAACCTGCGCAAGATCAATCGGGACCTGTTCGACTTCTCCACGCGCTTCATCACGCGG
CCGGCCAA
gtgaggcccggagaccccggcccgaggcgcccaggcctgagccccatgcctcccagcaac
cagggcccgcgggtgtggcccccaccagcccaggcctggactctcctcagttctgtgtcg
tgttcgggtttttcctctgtgactgggccgtcttggtgtctcgtggcacgcgtcacagtg

Predicted peptide sequence(s):


>WDR18_1|GENSCAN_predicted_peptide_1|508_aa
MAAPMEVAVCTDSAAPMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKN
YISAWELQRKDQLQQKIMCPGPVTCLTASPNGLYVLAGVAESIHLWEVSTGNLLVILSRH
YQDVSCLQFTGDSSHFISGGKDCLVLVWSLCSVLQADPSRIPAPRHVWSHHALPITDLHC
GFGGPLARVATSSLDQTVKLWEVSSGELLLSVLFDVSIMAVTMDLAEHHMFCGGSEGSIF
QVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQS
KQCIRTVALKGPVTNAAILLAPVSMLSSDFRPSLPLPHFNKHLLGAEHGDEPRHGGLTLR
LGLHQQTPRALGSFAPLVLAPVRRFPTSPALEGASSQHRPPLCAGLAQAPVCGVAICTPI
PSHILGRSRGGSEALGNDCMARGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTE
LEDEVRNLRKINRDLFDFSTRFITRPAX