GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:30:05

Sequence UQCRFS1_1 : 8347 bp : 42.23% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    951   1503  553  2  1  101   89   392 0.398  32.10
ccattagcattatcgagctttgcacagatgcctctggcctttttgttgttgttgttgtta
gatgaagataataaaaatcatcatagtaaacacatagcgattactatgtgctggacttcg
tcgtagttgagatatattaccatcctaagttaaactataatcgtttattgttatctctag
GTCTTCCTAGATGAAATTTTTACCCTAAAGGATCGTAAAGTCGGCCCACCGGACGTCAGT
GGGGTCCCCTGTTCAGCCCTCTCGTTCTTCTGGGGATCTCTCGGGACACTGACGAGGTGG
CACCGGGACCTACAGGTGGGCCGCAAGCCCCGCCCCCAGCGACGGCTTGTAGCCCCGTCC
CCCGACGCAGCGCCTCTCCAAGTTTGCCCCGCCCTGCAGGACTGCAGAATTTCCTTTCCG
GCGGCGCGCTGTCGTCACGCGTCCCGCGCCTCCTCGCGCCTGCGCCGTGGTTGGAAGGTC
GTCCCTGTGACCGGCTTGGCGGTTGGAGCGGCTGTCGCCATGTTGTCGGTAGCATCCCGC
TCAGGCCCGTTCGCGCCCGTCCTGTCGGCCACGTCCCGCGGGGTGGCGGGCGCGCTGCGG
CCCTTGGTGCAGGCCACGGTGCCCGCCACCCCGGAGCAGCCTGTGTTGGACCTGAAGCGG
CCCTTCCTCAGCCGGGAGTCGCTGAGCGGCCAGGCCGTGCGCCGGCCTTTGGTCGCCTCC
GTGGGCCTCAATG
gtgagccggggcgagggccgcgagcagggctgggggtctctcggtgcccgctcctccggc
ccccagcagggagcggccgcgggcgcgcgagcggagcctgaatcaggtcgggctgggcgg
cctccgcaactctgggcctggcccccgggctcggggcgtctttctggtggccggcctgga

 1.02 Term +   6250   6860  611  2  2  105   48   620 0.740  53.37
ttaagattttatatgctagcaccgccaatttgactatttctgagacccagtgagtgccat
atttcacatttttagaatttgattttttacctgtgaatccataaagggctatttcctgat
atatactcccttcgggatactcatctaattgtgttttttaaccttctgtttgtcttgcag
TCCCTGCTTCTGTTTGTTATTCCCACACAGACATCAAGGTGCCTGACTTCTCTGAATACC
GCCGCCTTGAAGTTTTAGATAGTACGAAGTCTTCAAGAGAAAGCAGCGAGGCTAGGAAAG
GTTTCTCCTATTTGGTAACTGGAGTAACTACTGTGGGTGTCGCATATGCTGCCAAGAATG
CCGTCACCCAGTTCGTTTCCAGCATGAGTGCTTCTGCTGATGTGTTGGCCCTGGCGAAAA
TCGAAATCAAGTTATCCGATATTCCAGAAGGCAAGAACATGGCTTTCAAATGGAGAGGCA
AACCCCTGTTTGTGCGTCATAGAACCCAGAAGGAAATTGAGCAGGAAGCTGCAGTTGAAT
TATCACAGTTGAGGGACCCACAGCATGATCTAGATCGAGTAAAGAAACCTGAATGGGTTA
TCCTGATAGGTGTTTGCACTCATCTTGGCTGTGTACCCATTGCAAATGCAGGAGATTTTG
GTGGTTATTACTGCCCTTGCCATGGGTCACACTATGATGCATCTGGCAGGATCAGATTGG
GTCCTGCTCCTCTCAACCTTGAAGTCCCCACGTATGAGTTCACCAGTGACGATATGGTGA
TTGTTGGTTAA
gagacttggactcaagtcataggcttctttcagtctttatgtcacctcaggagacttatt
tgagaggaagccttctgtacttgaagttgatttgaaatatgtaagaattgatgatgtatt
tgcaaacattaatgtgaaataaattgaatttaatgttgaatactttcaggcattcactta

Predicted peptide sequence(s):


>UQCRFS1_1|GENSCAN_predicted_peptide_1|387_aa
VFLDEIFTLKDRKVGPPDVSGVPCSALSFFWGSLGTLTRWHRDLQVGRKPRPQRRLVAPS
PDAAPLQVCPALQDCRISFPAARCRHASRASSRLRRGWKVVPVTGLAVGAAVAMLSVASR
SGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVAS
VGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAY
AAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQE
AAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASG
RIRLGPAPLNLEVPTYEFTSDDMVIVG