GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:20:12

Sequence TPM4_1 : 28483 bp : 50.21% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    733    858  126  0  0  150   67   261 0.538  31.08
cactatcaggtagcatggatggcgtggtgcatgctatcgcaacccctgttctacagataa
ggaaactgatgcccagagagagacggaggactcttgtgaatattgggggggaccgcccct
gcacctcggggacgtgaccccccccccaggctgacccgttcctcgctctgtcgtccccag
GTGGAGGAGGAGCTGACGCACCTCCAGAAGAAACTAAAAGGGACAGAGGACGAGCTGGAT
AAATATTCCGAGGACCTGAAGGACGCGCAGGAGAAGCTGGAGCTCACGGAGAAGAAGGCC
TCCGAC
gtacgtgtgcagggatgcgggagcccgcggcggggccaggccggagccccggggccggga
aggcggggagagccgcagggggaggaggaagaggaggaggagaaggcggcgcctcccagc
gctttctccaaataagtcccgaaaaggggcactttccagcagctgtggccagcggtgccg

 1.02 Intr +   1021   1383  363  0  0  -16   61   364 0.432  18.68
gagaagaaggcctccgacgtacgtgtgcagggatgcgggagcccgcggcggggccaggcc
ggagccccggggccgggaaggcggggagagccgcagggggaggaggaagaggaggaggag
aaggcggcgcctcccagcgctttctccaaataagtcccgaaaaggggcactttccagcag
CTGTGGCCAGCGGTGCCGACGTCAGGCCCTCCCCCAGCGGTGCTGACGTCGGCGGTCCGG
CCGGGTGACCTCATCGCCCCGACGGCAGCCGGCCCGGGGGGCGGGGAGAGGCGGGGGCGG
CCCCCGCGCAGGCAAAGGCTTGGGGGGCCGGGGCGCGGCTGTGCAGCTCTCGCCGGAGCC
GAGCCCAGCCGAGCGTCCGCCGCTGCCCGTGCGCCTCTGCGCCTCCGCGCCATGGCCGGC
CTCAACTCCCTGGAGGCGGTGAAACGCAAGATCCAGGCCCTGCAGCAGCAGGCGGACGAG
GCGGAAGACCGCGCGCAGGGCCTGCAGCGGGAGCTGGACGGCGAGCGCGAGCGGCGCGAG
AAA
gtgagcgccccggcctcgggccccgcacccgcagcctcctcccccgcgcgccctcctttc
ttcccggcttcccgcgctgcccgcccgcgcgcagtcctcgggccgcctttttacgccctc
ggacgccgatcgccgacccacatccctgcgcccgcagccaggaccccctacttcctccgc

 1.03 Intr +   6599   6732  134  1  2   73   94   278 0.990  26.34
agacattttccgggaagatcatactgaaattttggtatgagtgtaaattccctatggcct
ggactcctgggtgggctttgacggggaagatcaggttaacagagggcaggacatggggga
ggctcccactggtggctggcctgatacttcttaacatggctgcacctccgacctccccag
GCTGAAGGTGATGTGGCCGCCCTCAACCGACGCATCCAGCTCGTTGAGGAGGAGTTGGAC
AGGGCTCAGGAACGACTGGCCACGGCCCTGCAGAAGCTGGAGGAGGCAGAAAAAGCTGCA
GATGAGAGTGAGAG
gtaaggacgctttgaatctggtggcatccgtgtttgcttttagaaaatggggatcatgct
gccgacctcgcagagctggtgtgaaagtaaacaaggtcacaaggacatgcatgtgtccac
aaaaaagtgcatgacagcactttgtaaaccatcactccatgggtagagatgtttatccgt

 1.04 Intr +  11109  11226  118  0  1   51  105   252 0.988  23.67
aggaggctgaggcaggagaatcgcttgaacccgggaggtggaggttgcagtgagctgaga
tcgtgccactgcactccagcctggatgacagagcgagactccatctgaaagaaaagatag
atgagaggtgggtggaggggtgtgagtgaacggccgtcctgatgagattgctccttgcag
AGGAATGAAGGTGATAGAAAACCGGGCCATGAAGGATGAGGAGAAGATGGAGATTCAGGA
GATGCAGCTCAAAGAGGCCAAGCACATTGCGGAAGAGGCTGACCGCAAATACGAGGAG
gtgagtggggctggcagatggcgcagcagcaggaagtgggaggaaatgcatctgctgaga
tagggaggacaccggggccaacgaaaggaagctctcggttaggtcagctgtcctcctgcg
tgaacatatgtttgtccagagacaaccacttggctaggaaactatctcccacgatgccag

 1.05 Intr +  12713  12783   71  1  2  122   74    90 0.941   8.98
ctccagcctgggcaacagagggagactccgtccccctgcaaaaaaaagaaacaccagaaa
aacccatgttgcagctggtctaggggtctgggtggggcatcattgggggctgtctgcagt
ggatgggagaggacacggctggtggggatcgggctcagctgggcctttctgtctctgcag
GTAGCTCGTAAGCTGGTCATCCTGGAGGGTGAGCTGGAGAGGGCAGAGGAGCGTGCGGAG
GTGTCTGAACT
gtgagtggcagaacaggactgagcgaggctggctcgattcctggggcggagtgggaagga
gctggctgtgttgggaattggctctgaccggggtctctgctcaagtggacgggcgtcagg
ggctcatggctcatcttttctcttggcttctgtgacaaagaggtggtgacttgttcttac

 1.06 Intr +  13731  13806   76  0  1   58  100    81 0.992   5.82
gataagcccatagtatcacactgcagaaaaatccattaacattttctccccacattcctt
ctgccccccaccgggggagctgtgtaggtttctcctttggaaaatttattgttggggcga
ttgctattattgccggctgtaagggaagataagacacaaaaatcctttgtctttgtgcag
AAAATGTGGTGACCTGGAAGAAGAACTCAAGAATGTTACTAACAATCTGAAATCTCTGGA
GGCTGCATCTGAAAAG
gtaggtggttggcttgagctggagggtggcttgctggactttgttcttttcttctcccga
gggatgcaggagcctgtcaggttatggggaatctgccctttatttaacagtagcgttggt
gcctggcagccagggtttttcccctacagaaagagctggatttctcctgcacactcttga

 1.07 Intr +  18222  18284   63  2  0   89  105    96 0.949  10.31
tggctaatttttgtatttttagtagagacggggtttcaccatgttggccaggctggtctc
gaactcctgaccttgtgatccaccagcctcaggctcccaaagtgccaggattccaggcat
gagccaccatgcctggctgggcctccttttcttaaagcagtgttttggtttctcccacag
TATTCTGAAAAGGAGGACAAATATGAAGAAGAAATTAAACTTCTGTCTGACAAACTGAAA
GAG
gtgagtgtggtggcacccagcgagctctggtttctcctggggctggtcttgaagccatga
tagtaactcctttcttcttatctaggctgagacccgtgctgaatttgcagagagaacggt
tgcaaaactggaaaagacaattgatgacctggaaggtatgaggttaccatctaaatgttt

 1.08 Intr +  18370  18439   70  0  1  104   86    84 0.999   8.55
ttcttaaagcagtgttttggtttctcccacagtattctgaaaaggaggacaaatatgaag
aagaaattaaacttctgtctgacaaactgaaagaggtgagtgtggtggcacccagcgagc
tctggtttctcctggggctggtcttgaagccatgatagtaactcctttcttcttatctag
GCTGAGACCCGTGCTGAATTTGCAGAGAGAACGGTTGCAAAACTGGAAAAGACAATTGAT
GACCTGGAAG
gtatgaggttaccatctaaatgtttgccttgccctgccttcccctctgggacacatccac
ggacagttggggaatgtttgtggaggggctgggttgggctttgtttgccttaggaaagta
aagcgcatagtgatgtcatatctggatgtcctggaacactggaataggataatgcaaagc

 1.09 Term +  19950  20032   83  1  2   75   54   174 0.999  10.56
catagatctttggttttcttcatctgtttcacatggaacacagctttctcctagtctgtg
ctttgtttgctcacgtgtttttttcttcctcttgtggttcatctgtggcactccattccg
acccttgccttctgtcccctgtacttctgaactgtctccctggggacctccgccctctag
ATGAGTTATACGCTCAGAAGCTCAAGTACAAAGCTATCAGCGAGGAACTGGACCACGCTC
TCAACGACATGACCTCTCTCTGA
gaggcagccaggtcgctgccctctgtccttctcacatggtgcctcctacgcccctgtggg
cttctaggagctccggtggcctgccttctggtttgaacgtcagagccttcttctgatgtg
tctgtgactctacaaccgaaataaagacgggcagtcctcctcttcatgccccctcattct

Predicted peptide sequence(s):


>TPM4_1|GENSCAN_predicted_peptide_1|367_aa
VEEELTHLQKKLKGTEDELDKYSEDLKDAQEKLELTEKKASDLWPAVPTSGPPPAVLTSA
VRPGDLIAPTAAGPGGGERRGRPPRRQRLGGPGRGCAALAGAEPSRASAAARAPLRLRAM
AGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEE
ELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEE
ADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEK
EDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHA
LNDMTSL