GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:10:21

Sequence RAD23A_1 : 10201 bp : 54.33% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1310   1381   72  1  0  112   62   212 0.996  22.02
catgcccacaaaggccaaggagggagtgcgcaggtcacgtgcgccggtggtcagcgcgcg
cattgcctgccccggaagtggtcggcgcgcggcgcggcgcgcctgggcgctaagatggcg
gcggcgtgagttgcatgttgtgtgaggatcccggggccgccgcgtcgctcgggccccgcc
ATGGCCGTCACCATCACGCTCAAAACGCTGCAGCAGCAGACCTTCAAGATCCGCATGGAG
CCTGACGAGACG
gtgcgggccgggccggagcccgggggcgggagcgacgggtttcgggggtggggtgggggc
ggggaggctagaatcccaacgggaggggcagggaggacggcgcgggtcggccctgcccag
acccccgacctgcccgactttcctggaccccccgatggtctttggcccagcccccagccg

 1.02 Intr +   3209   3370  162  1  0  119   98   334 0.995  38.19
gtgttgaatggcatgatgattgaatgaattcaaatctagcatgctttagatgctgagaaa
gcttaaaaaacccagcgtgcttgcctttctgccatcagggctggcagtttctctgtccta
aactagaagggaaaagagaatcttggggtctccagtgactgtctgtaccactccctctag
GTGAAGGTGCTAAAGGAGAAGATAGAAGCTGAGAAGGGTCGTGATGCCTTCCCCGTGGCT
GGACAGAAACTCATCTATGCCGGCAAGATCTTGAGTGACGATGTCCCTATCAGGGACTAT
CGCATCGATGAGAAGAACTTTGTGGTCGTCATGGTGACCAAG
gtgggtgacgtgtgctggctgggagggtgggtggacgagctggggagctggcaaagagcc
tgtgtgcccaggagagattagctgtgaacagggcggggccacagcggagcgggttgttgg
gtctgatagggttgctgatgccagctccctttttcttgctgttgcagaccaaagccggcc

 1.03 Intr +   3538   3719  182  0  2  122   86    44 0.970   6.78
catggtgaccaaggtgggtgacgtgtgctggctgggagggtgggtggacgagctggggag
ctggcaaagagcctgtgtgcccaggagagattagctgtgaacagggcggggccacagcgg
agcgggttgttgggtctgatagggttgctgatgccagctccctttttcttgctgttgcag
ACCAAAGCCGGCCAGGGTACCTCAGCACCCCCAGAGGCCTCACCCACAGCTGCCCCAGAG
TCCTCTACATCCTTCCCGCCTGCCCCCACCTCAGGCATGTCCCATCCCCCACCTGCCGCC
AGAGAGGACAAGAGCCCATCAGAGGAATCCGCCCCCACGACGTCCCCAGAGTCTGTGTCA
GG
gtaaggcgggggcagcagtcccagcttgggccctgtcctcctagcacattccagcgtcca
cataagtggtcccacacacctggagggagggcaagccgccagaagccagggtccgatttc
tctctcttgaatttgcagctctgttccctcttcaggtagcagcgggcgagaggaagacgc

 1.04 Intr +   3858   3913   56  0  2   75   80    33 0.971   0.31
agaggaatccgcccccacgacgtccccagagtctgtgtcagggtaaggcgggggcagcag
tcccagcttgggccctgtcctcctagcacattccagcgtccacataagtggtcccacaca
cctggagggagggcaagccgccagaagccagggtccgatttctctctcttgaatttgcag
CTCTGTTCCCTCTTCAGGTAGCAGCGGGCGAGAGGAAGACGCGGCCTCCACGCTAG
gtgggtgggtggtccccagggcagaggtgactgggtgccccagccatcagctgggccttg
tctgggtgcgggagggcctgggagctgccctttcctcttcctggtgacctaggctttgct
gcttcctccacagtgacgggctctgagtatgagacgatgctgacggagatcatgtccatg

 1.05 Intr +   4047   4174  128  1  2   98   89   243 0.505  26.30
ctcttcaggtagcagcgggcgagaggaagacgcggcctccacgctaggtgggtgggtggt
ccccagggcagaggtgactgggtgccccagccatcagctgggccttgtctgggtgcggga
gggcctgggagctgccctttcctcttcctggtgacctaggctttgctgcttcctccacag
TGACGGGCTCTGAGTATGAGACGATGCTGACGGAGATCATGTCCATGGGCTATGAGCGAG
AGCGGGTCGTGGCCGCCCTGAGAGCCAGCTACAACAACCCCCACCGAGCCGTGGAGTATC
TGCTCACG
gtgaggtggggcttccgcctcccggggaggccttgagggagtacccgggcgtcactgccc
tgatgggcggttgggaaggcaaaacctgccctgaaaagcctttgggtagtgattctagcc
actaaaggcttcccacaggaggctggatgtgagtgatgggtgggcctctggagggcaggg

 1.06 Intr +   4484   4520   37  1  1   26   94    63 0.795  -0.98
ttcccacaggaggctggatgtgagtgatgggtgggcctctggagggcagggccgaggcct
catctgtgtcctgccagggcatggaggagggtggcagcaggaggtctgtgcattagaact
aaacaggacccctgacagggaattcctgggagccccgagccggaacacggttctgtccag
GAGAGCCAGGTATCGGAGCAGCCGGCCACGGAAGCAG
gtgggtgtgcacatgccgcatctgccctccaggtacctgactcacattacactccacccc
gcagtgctcctaggagcccggcgtggtgtctgactgcaccccttcctactaccagcagga
gagaaccccctggagttcctgcgggaccagccccagttccagaacatgcggcaggtgatt

 1.07 Intr +   4636   4769  134  2  2   64   64   194 0.658  15.47
ccccgagccggaacacggttctgtccaggagagccaggtatcggagcagccggccacgga
agcaggtgggtgtgcacatgccgcatctgccctccaggtacctgactcacattacactcc
accccgcagtgctcctaggagcccggcgtggtgtctgactgcaccccttcctactaccag
CAGGAGAGAACCCCCTGGAGTTCCTGCGGGACCAGCCCCAGTTCCAGAACATGCGGCAGG
TGATTCAGCAGAACCCTGCGCTGCTGCCCGCCCTGCTCCAGCAGCTGGGCCAGGAGAACC
CTCAGCTTTTACAG
gtgtggtcccaagggcagagggagctagggcagccaccatttcccttccctgtgggcacc
agagtccataacacgtaggaatcgttctaggtccggaaagcaggactaagcacatgcttc
ccccacgcccctgtgcttcctgtgacctggtgacccccctggtttctcagtcttcccaac

 1.08 Intr +   8050   8214  165  0  0  106   90   324 0.996  35.07
aaaagcacatcatcagctcttccagggtagggcttgtgtcgactgctatgttgtgtttgg
ccagaacaggctcctctggatatttgcctgactgaatgaaaaagcaagggctgtgatgac
ctggggagaggaggggaccagggctgtgaattaccttcccttccccaccctctcctgcag
CAAATCAGCCGGCACCAGGAGCAGTTCATCCAGATGCTGAACGAGCCCCCTGGGGAGCTG
GCGGACATCTCAGATGTGGAGGGGGAGGTGGGCGCCATAGGAGAGGAGGCCCCGCAGATG
AACTACATCCAGGTGACGCCGCAGGAGAAAGAAGCTATAGAGAGG
gtaagaggcctggctgaggggtgactgcaggtgggcaggacccctaccctctcctgctca
cacttaacctatcttcccacagttgaaggccctgggcttcccagagagcctggtcatcca
ggcctatttcgcgtgtgaaaaaaatgagaacttggctgccaacttcctcctgagtcagaa

 1.09 Term +   8297   8410  114  1  0  107   44   160 0.999  12.37
tctcagatgtggagggggaggtgggcgccataggagaggaggccccgcagatgaactaca
tccaggtgacgccgcaggagaaagaagctatagagagggtaagaggcctggctgaggggt
gactgcaggtgggcaggacccctaccctctcctgctcacacttaacctatcttcccacag
TTGAAGGCCCTGGGCTTCCCAGAGAGCCTGGTCATCCAGGCCTATTTCGCGTGTGAAAAA
AATGAGAACTTGGCTGCCAACTTCCTCCTGAGTCAGAACTTTGATGACGAGTGA
tgccaggaagccaggccaccgaagcccccaccctacccttattccatgaaagttttataa
aagaaaaaatatatatatattcatgtttatttaagaaatggaaaaaaaaatcaaaaatct
taaaaaaacaagcaaacagtccagcttcctgtcctcctaaagtggcccctgttcccatct

 2.02 PlyA -   9552   9547    6                               1.05
 2.01 Term -   9887   9569  319  1  1  111   54   477 0.967  41.30

Predicted peptide sequence(s):


>RAD23A_1|GENSCAN_predicted_peptide_1|349_aa
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAARE
DKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQNPAL
LPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEVGAIGEEAPQMNYI
QVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE

>RAD23A_1|GENSCAN_predicted_peptide_2|106_aa
XEQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQ
ELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS