GENSCAN 1.0	Date run: 15-Jan-104	Time: 19:39:53

Sequence PTPRS_1 : 82418 bp : 53.69% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1449   1539   91  2  1   97  116    74 0.539  11.16
ctccatgtgaccctccctctgcctcctccatgaaggtctcctggatttccccactcgcct
ctcacagccctccattgtctctgcagacgttgccccatctgacgctcggctcgaggcctc
tctgtgagggaccggggggccatccccctccagggcggagatcggaggtcgctgccaagc
ATGGCGCCCACCTGGGGCCCTGGCATGGTGTCTGTGGTTGGTCCCATGGGCCTCCTTGTG
GTCCTGCTCGTTGGAGGCTGTGCAGCAGAAG
gtaagaagccggcacgggatgtgcaggggtctgcgtgtttgtttacctgtgtgcatttat
ggctgtgtgtgtgtgggcacactccccacctcctccctggggccctccattttgccaaat
ggaacttttatgctccacaaatgaggctgaatgctgaggactgtgtgctgagccctaaga

 1.02 Intr +   5110   5219  110  2  2  101   81    36 0.487   4.70
ggctaatttttgtatttttggtagagatggggttttgccatgttggccaggctggtcttg
aactcttgacctcaggtgatctgcctgcctcagcttcccaaagtgctgggattataggtg
tgagcctctgcgccaggcctcttcacctttctgagcctgttttgctcctcctggccacag
GCATAAAGCTTAGCACATGGCGTGTCTTTGTGCCTCTCGAGCTGCAGGCGCGGCGCCCTC
AAGCCCCAGAGGTGTCCTTCCTGTGTCTCTGCCCCTTTGCTGAGAAAAAG
gtggggaagcttcgtccaaaggagagattgcaagcatttgcaagacattttctaacgggg
gactcagtgggcagggacagctcttccaggctggctcagatcccaaagctgcctggagaa
gaccgagagggtatctgctctgcagtgatgggggtgcttccgagaggtagaacccctcca

 1.03 Intr +   9476   9555   80  1  2   39   48    61 0.000  -3.96
tgaggtatgttcgtgccattgcactccagcctgggcagaagagcgagtccctgtctgaaa
caaaaaagcatcctttcccccaccccccactcccttttttttttttttttggcagtttct
acatttatttaaacacaaaacatgcacacgagccgtctactcattttcttcactgcgcag
CCTGGCATTGGGGTTGGTGACTCTGACGGCAGCTGGGCGGCCCTTTCCACGTTGGTTTTG
CGTTTCTTGGAGGAAACACT
gtgagcgatctcagcacagggagatttgttgcacatcagcacttccagctccttgacgct
ggggaccaggaacttccggaagccactgggcagcatgtgctttgttttttgttgctcccg
taaccactgttgggcatcaagatctggcccttgaacgttctgcgaaccctgttgtcaata

 1.04 Intr +  12910  12977   68  1  2   74   94    22 0.430   0.44
cccgcccccatgctgggtgcctcagtttccccacatgtctcaccaggaaattagaccaag
ttattctggcaagtgctttcagggccctccagggtttggctggtcaccatggaggggggg
ttcaggtgctgaatttagggaccccagcatctcacaggtttccccttccatctttcccag
TGGCACTGTGTCTGAGCAGGTGTGCCCAGGTGAGGTTGTATCCACTGTGTCTGAGCAGGT
GTGCCCAG
gtgaggttgtatccactgtgtgtgagcaggtgtggctgttgcaggtggaagtggggatat
gtgggcacctgggtgcccatgggtgccgtggtggggggcgaggtgggagggtgtttgttg
tcatccttgctttcctcctcctctcttcattggccacatggcacttccgtgggcagggca

 1.05 Intr +  13245  13390  146  1  2   91  105   222 0.885  24.71
gtggtggggggcgaggtgggagggtgtttgttgtcatccttgctttcctcctcctctctt
cattggccacatggcacttccgtgggcagggcatggaatgcaggttttcgtggctccttg
gtatcctagccagatgcctggacccatcagcgcccccccttctttccactgtatccccag
AGCCCCCCAGGTTTATCAAAGAACCCAAGGACCAGATCGGCGTGTCGGGGGGTGTGGCCT
CTTTCGTGTGTCAGGCCACGGGTGACCCCAAGCCACGAGTGACCTGGAACAAGAAGGGCA
AGAAGGTCAACTCTCAGCGCTTTGAG
gtgagttggggtagggggaggcagcctggggtcaatgctcccccaaggcagggccacagc
acctcagccacagtggacttcgtggacacgttccccaggtggagcatcatctgtggccaa
gcaagcatggctgcgcagcctccagccagggccctgcccgccttacttgctctaccagct

 1.06 Intr +  14006  14147  142  1  1   90   57   174 0.568  14.94
cggcgcatttatactggacaccgacacacgtgcacattcagcctgcagcaattctcccag
tcacccccaggatcatggggctgactgccattcccctacagcccagcctagcccagccta
gacaggaaccttcctgggaccccagcctcactctgttcttttttcccctgcccatggcag
ACGATTGAGTTTGATGAGAGTGCAGGGGCAGTGCTGAGGATCCAGCCGCTGAGGACACCG
CGGGATGAAAACGTGTACGAGTGTGTGGCCCAGAACTCGGTTGGGGAGATCACAGTCCAT
GCCAAGCTTACTGTCCTCCGAG
gtattgggctcctcagggcgggcggaggataaactgggccctgggctttggggacaagca
caaaaggaatacatgaaagttaccccaaaccctcctgctttgtgttttttgggaggacct
tgatctcccttatccaaccagtaacagtctcagggcccagcgcctactggtggggattta

 1.07 Intr +  22393  22581  189  2  0   92  109   300 0.308  32.58
gagcaagaccctgtctcaaaaaaagagagagaactggctgtaaaggatggcacccatggc
tgaggtcacgcagccagggaggagctggacccgtggccaggcagtccctgagccccaggc
tcaggagtggctgtgcagtgctcagaaccatgcccatttctctcacgtctctgccctcag
AGGACCAGCTGCCCTCTGGCTTCCCCAACATCGACATGGGCCCACAGTTGAAGGTGGTGG
AGCGGACACGGACAGCCACCATGCTCTGTGCAGCCAGCGGCAACCCTGACCCTGAGATCA
CCTGGTTCAAGGACTTCCTGCCTGTGGATCCTAGTGCCAGCAATGGACGCATCAAACAGC
TGCGATCAG
gtgagtgagggtggctgacaggacgtgggagccttggagggcagcagggggtggggagca
tctccagggcccaagttctggggactactggaggacagacagagacagtgtgtggccgtg
gcaggcgttggctctgggggagtgggggcaaatgtcttcaaagccgcacactgaggatat

 1.08 Intr +  29462  29572  111  0  0  113   75   211 0.480  23.15
ggggtggaggttatacaaggcctggccaagctagggcttccaggttttctcacctcttat
ctgcctctctggcccagccagcacaggagacaggccagagagcactctggtgggggagct
ttccctgttcactcctgggcccccctctaacagaccaagctttttcccatcttcccacag
GAGCCCTGCAGATTGAAAGCAGTGAGGAAACCGACCAGGGCAAATATGAGTGTGTGGCCA
CCAACAGCGCCGGCGTGCGCTACTCCTCACCTGCCAACCTCTACGTGCGAG
gtagggaacgccgcgtccaggtcaaaggcagggacccgccccgtcccatccccctccctc
ctcgggctcaccgcctccgggctcccccgtcccctgcacacccaagcaggaaggcccctc
cccggtcgcggtgggaccttggccgaggcggcgtccctctctgggccttagtttccttgc

 1.09 Intr +  41544  41813  270  1  0   89   56   511 0.049  46.05
gaaccagccctgtttatatttaaatggttttcctttttttttctttttttctttctttcc
ttctttctttcttccttcctgcttttctttttctcctccgcatcctgtcttcccctccca
acctcaccccacctcacccctcgcatctccctcccgccgccactgccgccccctccccag
TCCGCCGCGTGGCCCCGCGCTTCTCCATCCTGCCCATGAGCCACGAGATCATGCCAGGGG
GCAACGTGAACATCACCTGCGTGGCCGTGGGCTCGCCCATGCCATACGTGAAGTGGATGC
AGGGGGCCGAGGACCTGACCCCCGAGGATGACATGCCCGTGGGTCGGAACGTGCTGGAAC
TCACAGATGTCAAGGACTCGGCCAACTACACCTGCGTGGCCATGTCCAGCCTGGGCGTCA
TTGAGGCGGTTGCTCAGATCACGGTGAAAT
gtgagcagggcccatggggctcgtaggtggaggggcaggctggagtcgatccccgacttc
aggcacaggtgggaggcagcgtgggagcacctccgagttaccctcttggcttcagtcatt
catggctaggaaggggacggttgttctttgaacaggtattatttattggttataaatgat

 1.10 Intr +  43107  43688  582  1  0   86   78  1320 0.937 124.05
ggaccctgggccatagtttgttaccccttgctgtagacgatgacaggagtcatgaggccc
atgattactgctgggcaaatcaaggctcagagaaggcgactgaatggtgaaaagtcacac
agccttcagggtcctcaaccaatgtgcccaatgcgtgacacagctgcctcctgcccacag
CTCTCCCCAAAGCTCCCGGGACTCCCATGGTGACTGAGAACACAGCCACCAGCATCACCA
TCACGTGGGACTCGGGCAACCCAGATCCTGTGTCCTATTACGTCATCGAATATAAATCCA
AGAGCCAAGACGGGCCGTATCAGATTAAAGAGGACATCACCACCACACGTTACAGCATCG
GCGGCCTGAGCCCCAACTCGGAGTACGAGATCTGGGTGTCGGCCGTCAACTCCATCGGCC
AGGGGCCCCCCAGCGAGTCCGTGGTCACCCGCACAGGCGAGCAGGCCCCGGCCAGCGCGC
CGCGGAACGTGCAAGCCCGGATGCTCAGCGCGACCACCATGATTGTGCAGTGGGAGGAGC
CGGTGGAGCCCAACGGCCTGATCCGCGGCTACCGCGTCTACTACACCATGGAACCGGAGC
ACCCCGTGGGCAACTGGCAGAAGCACAACGTGGACGACAGCCTGCTGACCACCGTGGGCA
GCCTGCTGGAGGACGAGACCTACACCGTGCGGGTGCTCGCCTTCACCTCCGTCGGCGACG
GGCCCCTCTCGGACCCCATCCAGGTCAAGACGCAGCAGGGAG
gtgaggcgtggggtcggcaggactcggggccccggccgtgcggcttggttctttgcatgc
tccctggaagccgcagagcggtttgtgggttatgcacggtgctttaagatattttcatgc
tagcatttaggccgggtgtggtggtttacgcctgtaatctcagtactttgggaggccaag

 1.11 Intr +  47257  47390  134  2  2   95   78   218 0.995  22.37
ggatggaggaacagaggtggacaggtgacaatgggatgggggcgaggtccccaggaaaat
aaaagaacattctagaagcacccagagctggcatcttttagtggggacactcagcaggtg
gggccccctttgtggggtggacgctccccgactcctagttgtctccctgcacccccacag
TGCCGGGCCAGCCCATGAACCTGCGGGCCGAGGCCAGGTCGGAGACCAGCATCACGCTGT
CCTGGAGCCCCCCGCGGCAGGAGAGTATCATCAAGTACGAGCTCCTCTTCCGGGAAGGCG
ACCATGGCCGGGAG
gtgaggcagcgcggggacgggctggcctgccctgggctcctccccggcgctctctgacgc
tgcccgccttgtctcttccccctctttgtccctatgtgtgctgcggattctgctcttcct
caccccttctgcttctcctgcgtctctgtccctttgtgcctttcctccacttttttctcc

 1.12 Intr +  48526  48670  145  0  1  119   50   320 0.985  31.67
ctctccctcatccctctctgtccctctctgccgcacccctgtctctatttctctgtctct
ctctctctctctctctctccccctcccccctctgtttctgtctctctctctctccccttt
gtttctgtctctctctctctctcccccatccctctctgtccttctctgccctgcccccag
GTGGGAAGGACCTTCGACCCGACGACTTCCTACGTGGTGGAGGACCTGAAGCCCAACACG
GAGTACGCCTTCCGCCTGGCGGCCCGCTCGCCGCAGGGCCTGGGCGCCTTCACCCCCGTG
GTGCGGCAGCGCACGCTGCAGTCCA
gtaggtgtctcgcggggccgcccttctctgcgggagggaccacggcctgaccgcagacag
cccctcggcagacggacccaggcggggcctgctgcagtgggtggggggcgcctcccggcc
tgtctccgctttgttccccgacctcggatccatctacccgcgctgtgcctcagtatcccc

 1.13 Intr +  55974  56279  306  1  0  101  115   539 0.995  54.87
catcccacctttggttgacacccacttcttttgggttcgacttctctttggtttggttct
gttttgtttgttatcatcttcttttttattttctctttcccatcttttgtttccccgccc
ccctccccacccatcccacctcccttccccacccccccacgttctccccccctccaatag
AACCGTCAGCCCCCCCTCAAGACGTTAAATGTGTCAGCGTGCGCTCCACGGCCATTTTGG
TAAGTTGGCGCCCGCCGCCGCCGGAAACGCACAACGGGGCCCTGGTGGGCTACAGCGTCC
GCTACCGACCGCTGGGCTCAGAGGACCCGGAACCCAAGGAGGTGAACGGCATCCCCCCGA
CCACCACTCAGATCCTGCTGGAGGCCTTGGAGAAGTGGACCCAGTACCGCATCACGACTG
TCGCTCACACAGAGGTGGGACCAGGGCCCGAGAGCTCGCCCGTGGTCGTCCGCACCGACG
AGGATG
gtaagtacctgccccaggcccgggaccccccgcaggccccagcccggcccccgcctcgaa
gccttccatctggaaacctgggctggtggtcaaagggcggaagcctcactcggaggaagt
cgggaagcaagcagcctccccgagaaatccggggctccttgactttggaattggcgattc

 1.14 Intr +  57905  58098  194  0  2   84   80   459 0.977  44.43
gggctgtggggggtgtgcaggaggccatgtcctcccgcccggtggtgagcgctaagagcg
cccagttattcaccggcagccactcggcatcctggaatcggacagtggcactgcccgggg
cagggccgggcgccctggtaacggctccgcccgcccctcccctcccctcccgcccgccag
TGCCCAGCGCGCCGCCGCGGAAGGTGGAGGCGGAGGCGCTCAACGCCACGGCCATCCGCG
TGCTGTGGCGCTCGCCCGCGCCCGGCCGGCAGCACGGCCAGATCCGCGGCTACCAGGTCC
ACTACGTGCGCATGGAGGGCGCCGAGGCCCGCGGGCCGCCGCGCATCAAGGACGTCATGC
TGGCCGATGCCCAG
gtgggcggggggccggggcggggccggggacgggctccgggcggggacgggcccttgcgc
tccccccacctctgcttctctttctccatctctggcctcccccgctcaccttcctcctct
ctcccctgccgcctcctcccgcgctcagtgggagacggatgacacggccgaatatgtaag

 1.15 Intr +  58247  58273   27  1  0   93   92    51 0.239   4.80
gcatcaaggacgtcatgctggccgatgcccaggtgggcggggggccggggcggggccggg
gacgggctccgggcggggacgggcccttgcgctccccccacctctgcttctctttctcca
tctctggcctcccccgctcaccttcctcctctctcccctgccgcctcctcccgcgctcag
TGGGAGACGGATGACACGGCCGAATAT
gtaagtagcgcccctggccacccacctactgctgtgcgcttcccgcgggccgtgctgtgc
tgtgactcctgcacgccccttatcatcagtagtaaaacggtctcctcctctgggccctcc
catgcgcccctcgctctcccattacctcttggagcgcccagcctcgatgtttgcaccagg

 1.16 Intr +  61733  61862  130  1  1   57   85   200 0.362  17.37
ggctgggttgttgcatgtaccctctgagcatggccatgccacgtgtcgtggtctctgcat
gagctcatgtgcacgtctccacccctgatccgggccctgcatcctccttgcttgttctca
gcacggggagtgggggtgggtggggctgctcccagccccagccgtcgtgctgacccccag
CCGTGCCTGCAGGAGATGGTCATCACAAACTTGCAGCCTGAGACCGCGTACTCCATCACG
GTAGCCGCCTACACCATGAAGGGCGATGGCGCTCGCAGCAAACCCAAGGTGGTTGTGACC
AAGGGAGCAG
gtatgcaacccgccctcctcccacccaccaacagcccctttgcccccactggcaccagag
cgtgactccagagtccttgagctcacaagggcaggcagagggtgcaccaggcagctggaa
cagtgagacaaaggtgtgagggctgctcaggtgggtgtccagggcccagcttggcccccc

 1.17 Intr +  64292  64900  609  0  0  123  102  1202 0.999 118.11
tcgaggctgcagtgagccgtgatctcaccattgcactccaggctgggcaacagagtaaga
ccccccccaactcaaaaaaatgttatattgaaggaaaagaattaaaaatacaaccccacc
ttgtgcctctgggctggcggatggcgctgggaccctgacacctgccccgtatccccgcag
TGCTGGGCCGCCCAACCCTGTCGGTGCAGCAGACCCCCGAGGGCAGCCTGCTGGCACGCT
GGGAGCCCCCGGCTGGCACCGCGGAGGACCAGGTGCTGGGCTACCGCCTGCAGTTTGGCC
GTGAGGACTCGACGCCCCTGGCCACCCTGGAGTTCCCGCCCTCCGAGGACCGCTACACGG
CATCAGGCGTGCACAAGGGGGCCACGTATGTGTTCCGGCTTGCGGCCCGGAGCCGCGGCG
GCCTGGGCGAGGAGGCAGCCGAGGTCCTGAGCATCCCGGAGGACACGCCCCGTGGCCACC
CGCAGATTCTGGAGGCGGCCGGCAACGCCTCGGCCGGGACCGTCCTTCTCCGCTGGCTGC
CACCCGTGCCCGCCGAGCGCAACGGGGCCATCGTCAAATACACGGTGGCCGTGCGGGAGG
CCGGTGCCCTGGGCCCTGCCCGAGAGACTGAGCTGCCGGCAGCGGCTGAGCCGGGCGCGG
AGAACGCGCTCACGCTGCAGGGCCTGAAGCCCGACACGGCCTATGACCTCCAAGTGCGAG
CCCACACGCGCCGGGGCCCTGGCCCCTTCAGCCCCCCCGTCCGCTACCGGACGTTCCTGC
GGGACCAAG
gtaggcgcgcggcgacccctgcaccagagccggaccgggccttgcgcccacccccacccc
agccccctccctctcccctgcccaggtaagtgctcacttttctgcttcctcgtggtcact
caaggcaagtccggaccccgaggctccggcgttggcaaaggtgggacgtgcctcggtggc

 1.18 Intr +  64986  65060   75  1  0  122   81    60 0.994   8.68
cacggcctatgacctccaagtgcgagcccacacgcgccggggccctggccccttcagccc
ccccgtccgctaccggacgttcctgcgggaccaaggtaggcgcgcggcgacccctgcacc
agagccggaccgggccttgcgcccacccccaccccagccccctccctctcccctgcccag
GTAAGTGCTCACTTTTCTGCTTCCTCGTGGTCACTCAAGGCAAGTCCGGACCCCGAGGCT
CCGGCGTTGGCAAAG
gtgggacgtgcctcggtggcaccaccgccccccaccactgccccctccccttgctcccct
cccccctcttcctcctcctccaccttctttctgcagcctctgcacccgtgccgtctcccg
aagcagggacttgggacaggacagggcagggccgggccagggccaggcaggaaggccgtg

 1.19 Intr +  65369  65466   98  0  2   91   86   119 0.966  12.23
acttgggacaggacagggcagggccgggccagggccaggcaggaaggccgtgggcatggg
cacagcggacgacagggagcgcctgggccgccccaccccaccccgcttcacgccacccag
tgccaggcactcatggggcctctcttctgctctctccctgctcggccgcctccccggcag
TCTCGCCCAAGAACTTCAAGGTGAAAATGATCATGAAGACATCAGTTCTGCTCAGCTGGG
AGTTCCCTGACAACTACAACTCACCCACACCCTACAAG
gtgcgactgcccagccagcaggcaggcaggcaggcagggtcaggggttgtagttcagcag
ggcttaaggctcagtttggagttggtgtgaagtgagggatcagggctcagtcagagatgg
gtctcagctaggattgaggcttagtcaatactgggaatcagacttggggcccagcctagg

 1.20 Intr +  66336  66589  254  2  2   56   21   502 0.995  37.07
gggctcagtcagagttggggactcagcctgggatcagggatcagtcagtgttagatttct
gcctagggcaggattcagtgggatcagggctcagtcagggtgggggactcatcctggagc
tggggctcagtccatgggcatgagcccaccaggccctgctgagctagccctggtccgcag
ATCCAGTACAATGGGCTCACACTGGATGTGGATGGCCGTACCACCAAGAAGCTCATCACG
CACCTCAAGCCCCACACCTTCTACAACTTTGTGCTGACCAATCGCGGCAGCAGCCTGGGC
GGCCTCCAGCAGACGGTCACCGCCTGGACTGCCTTCAACCTGCTCAACGGCAAGCCCAGC
GTCGCCCCCAAGCCTGATGCTGACGGCTTCATCATGGTGTATCTTCCTGACGGCCAGAGC
CCCGTGCCTGTCCA
gtatgctcacccccatgctccgggttccttgtcacccccatcagcctactatatggctgg
ggcaagccacgtgccctctctgtgcctcaatttccttgcctatgaaacacagaccctatc
agccctagttcatggggtcatccaagattcaatgcttctcatgggtcattgtcactaaat

 1.21 Intr +  67236  67329   94  0  1  126   78    73 0.922  10.57
ccaaggcctggaggcctgagtcagcaactgtggcgtttgtggatggggcataggggaata
ggctcattgtatgaacagaagggaagactcagagaaacggcttcccccgtttgcccccat
gaagcatcccttggtcatccctatcgacagcccctctgactctttcccatctccctacag
GAGCTATTTCATTGTGATGGTGCCACTGCGCAAGTCTCGTGGAGGCCAATTCCTGACCCC
GCTGGGTAGCCCAGAGGACATGGATCTGGAAGAG
gtgagggcctggggcccaacccgcagggcccagatgcattccagttttcacgtgctctgt
tgctcccagctgagctctgagccacccatgactctgttcccgcagctcatccaggacatc
tcacggctacagaggcgcagcctgcggcactcgcgtcagctggaggtgccccggccctat

 1.22 Intr +  67399  67650  252  0  0   85   95   405 0.688  39.06
ttcccatctccctacaggagctatttcattgtgatggtgccactgcgcaagtctcgtgga
ggccaattcctgaccccgctgggtagcccagaggacatggatctggaagaggtgagggcc
tggggcccaacccgcagggcccagatgcattccagttttcacgtgctctgttgctcccag
CTGAGCTCTGAGCCACCCATGACTCTGTTCCCGCAGCTCATCCAGGACATCTCACGGCTA
CAGAGGCGCAGCCTGCGGCACTCGCGTCAGCTGGAGGTGCCCCGGCCCTATATTGCAGCT
CGCTTCTCTGTGCTGCCACCCACGTTCCATCCCGGCGACCAGAAGCAGTATGGCGGCTTC
GATAACCGGGGCCTGGAGCCCGGCCACCGCTATGTCCTCTTCGTGCTTGCCGTGCTTCAG
AAGAGCGAGCCT
gtaagtcctgaatggtgtccgcccacatccagacacacctctgaatgaggcagaccccat
tccccagggccctgacctctgtggtcagtcacaggcagctccctgtggtcagagctgggc
agaggggaagacttgggagcggagggatcctgaaacgaaggtttcttagaggaagagacc

 1.23 Intr +  68122  68279  158  0  2   97   74   233 0.993  22.12
agggaatggggagagcaaagattggcagggaccaggtcacataggccaccagggtcaagg
ttctaggaatataggaggatctagagcgggggagaaacgtaggttcatgtttgagaaaga
cccatctggccactacaaggagggtggacactgatggagacccccctcctttccctgcag
ACCTTTGCAGCCAGTCCCTTCTCAGACCCCTTCCAGCTGGATAACCCGGACCCCCAGCCC
ATCGTGGATGGCGAGGAGGGGCTTATCTGGGTGATCGGGCCTGTGCTGGCCGTGGTCTTC
ATAATCTGCATTGTCATTGCTATCCTGCTCTACAAGAA
gtaagccccatgtcctccccgacttgacttgacagcagggagggcttcctggaaaaggag
ggaggagttgtctcagagaatcatcactaaaggtctctgttgtacacatggggaaaccga
agttcagagaggttaagccacttgatcaaggtcacacagcatgggaatggcagagctagg

 1.24 Intr +  69057  69169  113  0  2   55   91   106 0.816   8.13
caggagaggggatgcccggctgcccccacagcttgtacacgtagctgtacttggtcctgg
aaaccctagtcatacgggtccatggtccttttcttaccatgcattcctggggcctgaatt
gtgttcacacatgaacatgtgccactactaactggactgttccgcttgcttctcctaaag
TAAACGCAAGGACTCAGAACCCCGCACCAAATGCCTCCTGAACAATGCCGACCTCGCCCC
TCACCACCCCAAGGACCCTGTGGAAATGAGACGCATTAACTTCCAGACTCCAG
gtatgtacttatccctggtaccagggatgccaccaacaggggagatagctggggagaagc
agtagctgccaccctgggggcccctcattggccccctctgaactatgcttggtgcagcca
cattctggattcccaaatacctccaaccctacatggatctgggcttggaactcataggtt

 1.25 Intr +  69287  69346   60  0  0   61   63    64 0.395   0.40
acctcgcccctcaccaccccaaggaccctgtggaaatgagacgcattaacttccagactc
caggtatgtacttatccctggtaccagggatgccaccaacaggggagatagctggggaga
agcagtagctgccaccctgggggcccctcattggccccctctgaactatgcttggtgcag
CCACATTCTGGATTCCCAAATACCTCCAACCCTACATGGATCTGGGCTTGGAACTCATAG

gttggttctgcttacaaccaagtgaggcttttttttttttaaagttaacatttaaccaat
ggctgctgtcctcttcaggagcctaaagacgatgtttaaaaaatggagaaaacacaaata
aacccctcatttctttgggcagaaagagctattcttctgtttatgtctctggttttaatg

 1.26 Intr +  72027  72091   65  1  2   72   83   130 0.134   9.83
ttcccctcctgccaagccccaccccggccatgcccttctaaccacagctcacccatcgca
gactcacacgtagatcacccccctcccccgagtccccggctggccccccaagtgaccaac
cccggcggggtctgctccaccctgtaggcatgcttagccacccgccaattcccatcgcag
ACATGGCGGAGCACACGGAGCGGCTCAAGGCCAACGACAGCCTCAAGCTCTCCCAGGAGT
ATGAG
gtgagcccacccccgcctcccaccctcatcacctcggcctcacaggcacctaccctgaca
cccgcgctctccccttcctctgtagtccatcgaccctggacagcagttcacatgggaaca
ttccaacctggaagtgaacaagccgaagaaccgctatgccaacgtcatcgcctatgacca

 1.27 Intr +  72177  72300  124  2  1  100   63   321 0.968  31.46
tgcttagccacccgccaattcccatcgcagacatggcggagcacacggagcggctcaagg
ccaacgacagcctcaagctctcccaggagtatgaggtgagcccacccccgcctcccaccc
tcatcacctcggcctcacaggcacctaccctgacacccgcgctctccccttcctctgtag
TCCATCGACCCTGGACAGCAGTTCACATGGGAACATTCCAACCTGGAAGTGAACAAGCCG
AAGAACCGCTATGCCAACGTCATCGCCTATGACCACTCCCGTGTCATCCTCCAGCCCATT
GAAG
gtagttcggagatcccgggtcttaacctgcccttccccactgcatggaaagtgctagatc
ccatgtctccccttgggccactgaggcctgattctggtcatagacctggtccagctccaa
ctggaggccactgggcatctttagatatgtatttaactgatggctgctctctctaacatg

 1.28 Intr +  72853  73028  176  2  2   66   88   408 0.999  38.78
gcgatctggccccaaatggtgatggcgctgagggggagaaactgtgaagtacacgtccca
tggtcaccttggggacaatctgggagcggtcagagtgaacttccaggaagtggttggcca
cacagagccaaactagcaagacagcccccacagatccctggcctctcgccctggctgcag
GCATCATGGGCAGTGATTACATCAATGCCAACTACGTGGACGGCTACCGGTGTCAGAACG
CGTACATTGCCACGCAGGGGCCGCTGCCTGAGACCTTTGGGGACTTCTGGCGTATGGTGT
GGGAGCAGCGGTCGGCGACCATCGTCATGATGACGCGGCTGGAGGAGAAGTCACGG
gtgagccttggaccccacggccctcaagcccctgccagtcagcctgtccctgctgacacc
tgttctcttgcccgatacagatcaagtgtgatcagtattggcccaacagaggcacggaga
cctacggcttcatccaggtcacgttgctagataccatcgagctggccacattctgcgtca

 1.29 Intr +  73109  73228  120  1  0   93   81   165 0.998  17.49
ggggccgctgcctgagacctttggggacttctggcgtatggtgtgggagcagcggtcggc
gaccatcgtcatgatgacgcggctggaggagaagtcacgggtgagccttggaccccacgg
ccctcaagcccctgccagtcagcctgtccctgctgacacctgttctcttgcccgatacag
ATCAAGTGTGATCAGTATTGGCCCAACAGAGGCACGGAGACCTACGGCTTCATCCAGGTC
ACGTTGCTAGATACCATCGAGCTGGCCACATTCTGCGTCAGGACATTCTCTCTGCACAAG

gtggggcccaggctggggctgggggctgagggtggaggaatgtgttggaagggaggcaga
gggccccagcttctacccagggagctccccatgggacagagagaaagcggagcgtgtcta
cccaggctgactacattctcatggaacccacttccgtggagggggaaactgaggctcaga

 1.30 Intr +  75098  75252  155  1  2   67   98   217 0.999  19.98
aggtttctccatgttggtcaggctggtctcgaactcctgacctcaggtgatccgcccacc
tcggcctcccaaagtgctgggataacaggcatgagccaccacacccggccacttgggcat
cttcagcacatgggtggcaggttgagccggagtgacaggtgacatccttgtggtccccag
AATGGCTCCAGTGAGAAACGCGAGGTCCGCCAGTTCCAGTTTACGGCGTGGCCGGACCAT
GGCGTGCCCGAATACCCAACGCCCTTCCTGGCTTTCCTGCGGAGAGTCAAGACCTGCAAC
CCGCCAGATGCCGGCCCCATCGTGGTTCACTGCAG
gtacgtccaccccactctgccccatccgcttccccccggtccccgcagcccagcagcccc
tgaacgccacgtggctgtccctgcagtgccggtgtgggccgcacaggctgctttatcgtc
atcgacgccatgcttgagcggatcaagccagagaagacagtcgatgtctatggccacgtg

 1.31 Intr +  75339  75624  286  0  1   89   45   600 0.970  53.69
gcgtgcccgaatacccaacgcccttcctggctttcctgcggagagtcaagacctgcaacc
cgccagatgccggccccatcgtggttcactgcaggtacgtccaccccactctgccccatc
cgcttccccccggtccccgcagcccagcagcccctgaacgccacgtggctgtccctgcag
TGCCGGTGTGGGCCGCACAGGCTGCTTTATCGTCATCGACGCCATGCTTGAGCGGATCAA
GCCAGAGAAGACAGTCGATGTCTATGGCCACGTGACGCTCATGAGGTCCCAGCGCAACTA
CATGGTGCAGACGGAGGACCAGTACAGCTTCATCCACGAGGCCCTGCTGGAGGCCGTGGG
CTGTGGCAACACAGAAGTGCCCGCACGCAGCCTCTATGCCTACATCCAGAAGCTGGCCCA
GGTGGAGCCTGGCGAACACGTCACTGGCATGGAACTCGAGTTCAAG
gtgccagcggggtggaggctgctgtgggcggggtggggaggaggcccaaagagccgaaaa
tcaggcccgcctcgagcaatggggactagaaggtggtggcagggtgcccctacctaccta
tccaccattggtgctccagctgaaagcatagccttcctcatcctgatggtggcctctggc

 1.32 Intr +  75821  75999  179  1  2  115   96   302 0.999  32.93
ggctgctgtgggcggggtggggaggaggcccaaagagccgaaaatcaggcccgcctcgag
caatggggactagaaggtggtggcagggtgcccctacctacctatccaccattggtgctc
cagctgaaagcatagccttcctcatcctgatggtggcctctggcttcctcctccccacag
CGGCTGGCTAACTCCAAGGCCCACACGTCACGCTTCATCAGTGCCAATCTGCCTTGTAAC
AAGTTCAAGAACCGCCTGGTGAACATCATGCCCTATGAGAGCACACGGGTCTGTCTGCAA
CCCATCCGGGGTGTGGAGGGCTCTGACTACATCAACGCCAGCTTCATTGATGGCTACAG
gtaggtgccatgcctttcccacctcagggccccagaaggagcccatctctactctcaaga
ggcctccagtcttgtgggagacagagctggggagatactggtagccctgagctgtttaaa
tacacatctttagatgtatatttaactgatggctgctgtccgtgaatctttgggtgtgtg

 1.33 Intr +  76784  76910  127  2  1   78   88   243 0.999  24.49
ccacatgcaaaatgggatcaccaggaggggaagtggtgcacccagcagccattcctggca
ggcagtggggtggtaggtgtagctgtcactggcttggtcctgaccctcccgggcagcatc
aggtgagtaccacgccgggtctccctgccggccctgggctcatacccccaacgcctgcag
GCAGCAGAAGGCCTACATCGCGACACAGGGGCCGCTGGCGGAGACCACGGAAGACTTCTG
GCGCATGCTGTGGGAGAACAATTCGACGATCGTGGTGATGCTGACCAAGCTGCGGGAGAT
GGGCCGG
gtgagctaggggccacagcagggaagggcgagggccagactgtggctcagacagcgctga
ccacggccgccatctcctccacaggagaagtgtcaccagtactggccggccgagcgctct
gcccgctaccagtactttgtggtagatccgatggcagaatacaacatgcctcagtatatc

 1.34 Intr +  76995  77120  126  2  0  123  100   159 0.998  21.98
ccgctggcggagaccacggaagacttctggcgcatgctgtgggagaacaattcgacgatc
gtggtgatgctgaccaagctgcgggagatgggccgggtgagctaggggccacagcaggga
agggcgagggccagactgtggctcagacagcgctgaccacggccgccatctcctccacag
GAGAAGTGTCACCAGTACTGGCCGGCCGAGCGCTCTGCCCGCTACCAGTACTTTGTGGTA
GATCCGATGGCAGAATACAACATGCCTCAGTATATCCTGCGAGAGTTCAAGGTCACAGAT
GCCCGG
gtgagtgaagagacagactggcgggaggggctggagccttagtgatctggaaagggctgc
cctggttggtgatggatacaaaggccaagggttaggcataagcattgggaatcaggagaa
gtgtcagctgaccagttggccacttgcttctactgccacataggtggaagagagggtctt

 1.35 Intr +  79198  79352  155  0  2   82   99   159 0.999  15.78
aggtggaggttgcagtgagccgagatcacgccattgcactccaacctgggcgacaagagt
gaaactccatctcaaaaacaaacaaacaaacaaaaaatgggggtgaagatagggaggatg
gagaaaaacccccatggccgctgctgacctgataacaagattgggctctctgcactctag
GATGGCCAGTCCCGGACTGTCCGGCAGTTCCAGTTCACAGACTGGCCGGAACAGGGTGTG
CCAAAGTCGGGGGAGGGCTTCATCGACTTCATTGGCCAAGTGCATAAGACTAAGGAGCAG
TTTGGCCAGGACGGCCCCATCTCTGTCCACTGCAG
gtgagctccctcgagtgtcccagcttttggccctgctggggaaactgaggcctggtgggg
acagccccaagcttaggctgtcccatctgggctgttagagtcctcggggaatcgggtggt
cagatcagggctccccagcacctgcccctgaatggctgtgctcactttactgccaccagt

 1.36 Intr +  79532  79667  136  2  1   58   88   267 0.655  24.78
ggtgagctccctcgagtgtcccagcttttggccctgctggggaaactgaggcctggtggg
gacagccccaagcttaggctgtcccatctgggctgttagagtcctcggggaatcgggtgg
tcagatcagggctccccagcacctgcccctgaatggctgtgctcactttactgccaccag
TGCCGGCGTGGGCAGGACGGGCGTCTTCATCACGCTTAGCATCGTGCTGGAGCGGATGCG
GTATGAAGGCGTGGTGGACATCTTTCAGACGGTGAAGATGCTACGAACCCAGCGGCCGGC
CATGGTGCAGACAGAG
gtaaagatgggacagggaggggaggcagcctggcctcacgccccgactgcccctaagctc
cagtttcctcctctgtgagatgggtacagccacctgggactctctgggtcactgtgggta
gacggtccacagacccctcccgcactggaaggggaccagtaacccttttaacacaacagt

 1.37 Term +  80747  80815   69  1  0   90   42    94 0.982   3.23
tgttaggcagagaggtgtggcatagctcacttcattgtgggagggccgtgggggccaaag
agaccttctgcaagagacacgcacaaggctgaggagcttggcctgctcctgagggcgata
gggagccctgggaggcgttagagcagcggaggtactaacaggtcacctctgctcccccag
GATGAGTACCAGTTCTGTTACCAGGCGGCACTGGAGTACCTCGGAAGCTTTGACCACTAT
GCAACCTAA
agccatggttccccccaggcccgacaccactggccccggatgcctctgcccctcccgggc
ggacctcctgaggcctggacccccagtgggcagggcaggaggtggcagcggcagcagctg
tgtttctgcaccatttccgaggacgacgcagcccctcgagcccccccaccggccccggcc

Predicted peptide sequence(s):


>PTPRS_1|GENSCAN_predicted_peptide_1|2051_aa
MAPTWGPGMVSVVGPMGLLVVLLVGGCAAEGIKLSTWRVFVPLELQARRPQAPEVSFLCL
CPFAEKKPGIGVGDSDGSWAALSTLVLRFLEETLGTVSEQVCPGEVVSTVSEQVCPEPPR
FIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQ
PLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATM
LCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAG
VRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTP
EDDMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATS
ITITWDSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNS
IGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTME
PEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQ
PMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLKPN
TEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETH
NGALVGYSVRYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPE
SSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAE
ARGPPRIKDVMLADAQWETDDTAEYPCLQEMVITNLQPETAYSITVAAYTMKGDGARSKP
KVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEF
PPSEDRYTASGVHKGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASA
GTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPD
TAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQGKCSLFCFLVVTQGKSGPRGSGVGKVSPK
NFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDVDGRTTKKLITHLKPHTFYNFV
LTNRGSSLGGLQQTVTAWTAFNLLNGKPSVAPKPDADGFIMVYLPDGQSPVPVQSYFIVM
VPLRKSRGGQFLTPLGSPEDMDLEELSSEPPMTLFPQLIQDISRLQRRSLRHSRQLEVPR
PYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAASPFSDPF
QLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKRKDSEPRTKCLLNNADL
APHHPKDPVEMRRINFQTPATFWIPKYLQPYMDLGLELIDMAEHTERLKANDSLKLSQEY
ESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRC
QNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQ
VTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTC
NPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQ
YSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRF
ISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPL
AETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQ
YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPIS
VHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAAL
EYLGSFDHYAT