GENSCAN 1.0	Date run: 15-Jan-104	Time: 17:46:26

Sequence PPP1R14A_1 : 7695 bp : 56.21% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1394   1594  201  1  0   85   89   454 0.936  44.06
gcagcggcctactctcgcactgcagacggggaaactgaggcctgaggcggccggggtggg
gcagacctcccggcgagcccgagcccccgcccccggctagccccgccctggcccgtaaga
agcacccggggcgcgaggcgaaggcgcacagcgcggggccaggctgggtccagcagcgcg
ATGGCAGCTCAGCGGCTGGGCAAGCGCGTGCTGAGCAAGCTGCAGTCTCCATCGCGGGCC
CGCGGGCCAGGGGGCAGTCCCGGGGGGCTGCAGAAGCGGCACGCGCGCGTCACCGTCAAG
TATGACCGGCGGGAGCTGCAGCGGCGGCTGGACGTGGAGAAGTGGATCGACGGGCGCCTG
GAGGAGCTGTACCGCGGCATG
gtgagcccggggagggctcgggggtggtcggggacagatagagcccgggcgcggagaccc
cacgcccttggggtctcggtgcacactcgctggtgcacggccagcctggtctgcacaaga
ggacgagcgccccagggccgggcactcattggcctggccatccgtgctctatggcattgt

 1.02 Intr +   4759   4839   81  0  0   80   96   121 0.948  12.43
tcacccctcccccccaacacccagatgtcccgtcttggcagtgctgtcccggactgccac
attaatgctccagaacccgccagctgggccctggggccggtggggctcctgcagagccct
ggacaaaggcgagggagggagggaaggggatcctaagcacccctccctccctggccctag
GAGGCAGACATGCCCGATGAGATCAACATTGATGAATTGTTGGAGTTAGAGAGTGAAGAG
GAGAGAAGCCGGAAAATCCAG
gtaggtggggggacgtgtcccccagcctcccactttgcacctccctaaaaataatagcaa
tagttcacgtgtttactgagtgctcactagatgccgggcactggtgtgatggctttacat
gtattcactcacttaaccctcacaaaaccctccgaagcaggcgctagtgtgagctccatt

 1.03 Term +   6287   6415  129  1  0   79   46   101 0.985   3.49
cccatctctgtctttctcccggctcacttttctctctatgtctatagcctccgcccctaa
ctccccccaccccacaatcagagaacaggaggaggcgcccaggtcagggactgggctgga
caggggcagagggtgcccccgcactgttcccatgttctcagctcccccaccctgtctcag
GACTTCATCCAGGAGCTGCTGGCAAAGCTTCAAGGCCTCCACAGGCAGCCCGGCCTCCGC
CAGCCAAGCCCCTCCCACGACGGCAGCCTCAGCCCCCTCCAGGACCGGGCCCGGACTGCT
CACCCCTGA
ccctcttgcactctccctgccccccggacgccgcccagcttgcttgtgtataagttgtat
ttaatggttctgtaacaataacactgtgtggctgtttttcctccccccgggttaccatgg
gcttccccgagctccccccacaacctccctctctcctcctgtggcctctgctcatgtccc

Predicted peptide sequence(s):


>PPP1R14A_1|GENSCAN_predicted_peptide_1|136_aa
MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRL
EELYRGMEADMPDEINIDELLELESEEERSRKIQDFIQELLAKLQGLHRQPGLRQPSPSH
DGSLSPLQDRARTAHP