GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:05:51

Sequence PAFAH1B3_1 : 7938 bp : 53.65% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1447   1540   94  1  1   99   93   145 0.731  16.57
acctcctaagtgaaggcttccgtccctggagaggaggcggcgccctgtatcggccttcgt
cctccgcgggtgtgctagcgttgggacggtcctttgttgccgcgaggggtaggagtgggc
gtggcggagccagctccgttcggaacactcccgggccgacccgactcgctcatcctgcag
GAGCTGCGGCGCCAAGATGAGTGGAGAGGAGAACCCAGCCAGCAAGCCCACGCCGGTGCA
GGACGTACAGGGCGACGGGCGCTGGATGTCCCTG
gtgagcgttcccacctgggatattgaggagtccgggggcgcggggggtggctcaggagaa
cggctggttcgtgccactctcactacctgattgggaaactgagggcagttgaggaggcgc
tgcctaagggagcagggcggggcgggccctggagcgtgcatgccattgactccctctcgc

 1.02 Intr +   1733   1822   90  1  0  102   78   188 0.998  19.89
acctgggatattgaggagtccgggggcgcggggggtggctcaggagaacggctggttcgt
gccactctcactacctgattgggaaactgagggcagttgaggaggcgctgcctaagggag
cagggcggggcgggccctggagcgtgcatgccattgactccctctcgcgcgctcccgcag
CACCATCGGTTCGTGGCTGACAGCAAAGATAAGGAACCCGAAGTCGTCTTCATCGGGGAC
TCCTTGGTCCAGCTCATGCACCAGTGCGAG
gtgagggcagtccctctccccctgccccatccagccctgtgtccatgctgacacatctgg
accagaacccaggccaggtgaggtattatgagagtacccagattggcctcaggcagcccg
aggctctgagaatcttggtgtaaggtgcaacattctattgagaaagaaatgtatgccttg

 1.03 Intr +   3485   3601  117  1  0   95  105   121 0.979  15.67
ctataaagtgaggttcagccatgctggagtttgctccaggtaaaattttaagactgcttc
catgaagtaaggttcttccataatggcatttggttaacacctggacagagggggatggtc
catgcggacagtgcccttgtgcccctaccacttcttgcccacaccacttcttgcccacag
ATCTGGCGCGAGCTCTTCTCTCCTCTGCATGCACTTAACTTTGGCATTGGTGGTGACGGC
ACACAGCATGTACTGTGGCGGCTGGAGAATGGGGAGCTGGAACACATCCGGCCCAAG
gtgagcggggcttgggtggggctctaaaacatcttttggctgccccctcaccgctgcttc
atgtctctttttccacagattgtggtggtctgggtgggcaccaacaaccacggacacaca
gcagagcaggtgactggtggcatcaaggccattgtgcaactggtgaatgagcgacagccc

 1.04 Intr +   3680   3802  123  1  0  132   85   164 0.998  21.79
ttctctcctctgcatgcacttaactttggcattggtggtgacggcacacagcatgtactg
tggcggctggagaatggggagctggaacacatccggcccaaggtgagcggggcttgggtg
gggctctaaaacatcttttggctgccccctcaccgctgcttcatgtctctttttccacag
ATTGTGGTGGTCTGGGTGGGCACCAACAACCACGGACACACAGCAGAGCAGGTGACTGGT
GGCATCAAGGCCATTGTGCAACTGGTGAATGAGCGACAGCCCCAGGCCCGGGTTGTGGTG
CTG
gtgagaggctgggagagtgggaaaggaagaatggcagtggtctgggaccccctcagatat
agccacagttggcacagttctaggcagcttgacatagagcagtggcttttaggcagaatc
tcacgttggagcttgctatacccttcagagtggctgtggttgagaatatgctccgagacc

 1.05 Term +   6407   6694  288  1  0   73   47   275 0.490  17.62
tcttgctaaatgagggctaggatgtgatatttaggaactaccctcccaccctccccactt
gcccatccctagtgttttctgcagctggaaacttcatggtggtgggtggaggacaggttg
gcacagagaacaagatactcaaatgcttgtttccttactacgcctcgtgttcctgctcag
GGCCTGCTTCCGCGAGGCCAACATCCCAACCCACTTCGGGAGAAGAACCGACAGGTGAAC
GAGCTGGTACGGGCGGCACTGGCTGGCCACCCTCGGGCCCACTTCCTAGATGCCGACCCT
GGCTTTGTGCACTCAGATGGCACCATCAGCCATCATGACATGTATGATTACCTGCATCTG
AGCCGCCTGGGCTACACACCTGTTTGCCGGGCTCTGCACTCCCTGCTTCTGCGTCTGCTG
GCCCAAGACCAGGGCCAAGGTGCTCCCCTGCTGGAGCCCGCACCCTAA
gcatcctgctgccttcccacaacattaaactctccttcctcagtgtgctgtttcctgctt
tatggtcgaacctgtctgggtatctgggtaccaccattagtccttatcctgatctgtgac
cctgcagttctgcaaggtgttttttgtgtgagacagggtctctctccgtcacccaggcta

Predicted peptide sequence(s):


>PAFAH1B3_1|GENSCAN_predicted_peptide_1|237_aa
XSCGAKMSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQ
CEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVT
GGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDA
DPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP