GENSCAN 1.0	Date run: 15-Jan-104	Time: 19:42:30

Sequence NDUFA11_1 : 11366 bp : 58.88% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1297   97  0  1   75   93   189 0.724  18.67
gcgcgtgcgcgcgatccatgtccatgtccgcgcctatcaataaagttgctcacttgttgc
cggcccgctagcccgaaaggttgcgcgcgcagcccgagaagtctcgcgatagccagccgc
ggctgcccttgcgcttcccgagctggcggggtccgtggtgcgggatcgagattgcgggct
ATGGCGCCGAAGGTTTTTCGTCAGTACTGGGATATCCCCGATGGCACCGATTGCCACCGC
AAAGCCTACAGCACCACCAGTATTGCCAGCGTCGCTG
gtgagcgccggccgggccccgagggtggagggccgaggccgcagggaggtcgtggggtta
ctgggggctgtttggatcgaacgggtctgggagtctcgcgggtacgcacgtggttgtcat
cggggtgtcttgggcggtcgtagggggggatcttgtgtgaaatggatgttggtagggggt

 1.02 Intr +   7912   8004   93  2  0  115   99    68 0.989  11.70
gttttggagcagcaaacccgagttcaaatccagctctgccactcagcagccggggacact
atgggcaaagaaggggggcatcgtgaggactgagggagggagaccacccagtggggtgcc
cggccaagcaagggcttagcagcagtggggtctgaacagcctccctcctctgtctcgcag
GCCTGACCGCCGCTGCCTACAGAGTCACACTCAATCCTCCGGGCACCTTCCTTGAAGGAG
TGGCTAAGGTTGGACAATACACGTTCACTGCAG
gtgagcacgctgggctgggcatggctgggccctctcctggcacagccccagctctcagag
cacatttgacggctgcctcttctctctgactccccagcccgtgtccacagtgctggccat
ccggagaaagtggggtgttcctttatcaggaatacatgtagggtggggaggcccaggaga

 1.03 Intr +   8115   8267  153  1  0  105   47    19 0.473   0.73
gtcacactcaatcctccgggcaccttccttgaaggagtggctaaggttggacaatacacg
ttcactgcaggtgagcacgctgggctgggcatggctgggccctctcctggcacagcccca
gctctcagagcacatttgacggctgcctcttctctctgactccccagcccgtgtccacag
TGCTGGCCATCCGGAGAAAGTGGGGTGTTCCTTTATCAGGAATACATGTAGGGTGGGGAG
GCCCAGGAGAACAGCTCCAGGACTGGGGCCAGGAGGCTGCCATGCACAGCGAGCAGCCGA
CTCGTGGCATCTCTCTCCATCCAGACACTGGCA
gtgagcgcccaagaggctcctgctgtgcccgtctcgaggcccttgctcttcccgtctacc
ccgcagctgctgtcggggccgtgtttggcctcaccacctgcatcagcgcccatgtccgcg
agaagcccgacgaccccctgaactacttcctcggtggctgcgccggaggcctgactctgg

 1.04 Intr +   8334   8456  123  1  0  113   73   200 0.771  22.73
gaatacatgtagggtggggaggcccaggagaacagctccaggactggggccaggaggctg
ccatgcacagcgagcagccgactcgtggcatctctctccatccagacactggcagtgagc
gcccaagaggctcctgctgtgcccgtctcgaggcccttgctcttcccgtctaccccgcag
CTGCTGTCGGGGCCGTGTTTGGCCTCACCACCTGCATCAGCGCCCATGTCCGCGAGAAGC
CCGACGACCCCCTGAACTACTTCCTCGGTGGCTGCGCCGGAGGCCTGACTCTGGGAGCAC
GCA
gtgagtggccccctccccacccccaccctcctcccagcctggcagaatgacccctgacct
ctgctcatcctccaccctctctgttccatcccggacaagaagtaaagcagccttcttgaa
caccagccatttcagtcatagcgacagctgctgctgctgcttaagcacctactgtggccc

 1.05 Intr +  10055  10161  107  0  2  113   70   142 0.686  16.00
gtgcatcagtttccacatctccagagtctagggccctcttcctgagtgacttaatccctg
aagagagtgtcctgtcaggggtctcagtctggctcccagggtgggcaccggccagggcgt
ggagcgtcttggtccggccgagccccacccgggcctgacatcacctccccactcccacag
CGCACAACTACGGGATTGGCGCCGCCGCCTGCGTGTACTTTGGCATAGCGGCCTCCCTGG
TCAAGATGGGCCGGCTGGAGGGCTGGGAGGTGTTTGCAAAACCCAAG
gtgtgagccctgtgcctgccgggacctccagcctgcagaatgcgtccagaaataaattct
gtgtctgtgtgtgtgtcagtgtccggagggcttgatgacggcgacacagcagccggtgag
ggcggatctgggagggagtgaggaagggagataagataaggccccctgcacacgcgcctg

 1.06 Intr +  10584  10724  141  2  0   79   43    43 0.215   0.63
ggctggggccatcgggagcccaggaggggagacggctgggatgcgccccagcctctgctt
cccccagttcccagggcagggcaggagcgtgccagtgacctgccagcaagtggaaaatgg
gccctgccgcccacagcccttccctcagcgctgtgggctctggtcacaacccccctgcag
ATCTTGAGCCATCCTTTCTCTGGGCCTGTCCCCAAAGCCAACAACATGTGGAAAACACGC
CCAGGCCCTGTCTCCAAATTCCTGGGCACTGGAGCGGAGAGCCCCGGACAGGCTGGTCCA
GCAGCCGTCCCCATCCGGCAG
gtcactcgcagcccctggggctagggcagagcgggacaggacccccctcagcacctggct
ggtggcagcgacaagggaaagaattgcgatcccttcctgccacctgtcaggccagtgatt
taggtggccctggaatgctggcaccaccccgggccccttctccagaactggctcatgctc

Predicted peptide sequence(s):


>NDUFA11_1|GENSCAN_predicted_peptide_1|238_aa
MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYT
FTAVLAIRRKWGVPLSGIHVGWGGPGEQLQDWGQEAAMHSEQPTRGISLHPDTGTAVGAV
FGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGR
LEGWEVFAKPKILSHPFSGPVPKANNMWKTRPGPVSKFLGTGAESPGQAGPAAVPIRQ