GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:28:03

Sequence NAPA_1 : 29769 bp : 55.59% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1271   1368   98  1  2  116   72   132 0.244  14.30
cgttacgaggccgctggttggccagcgctagtcacgtggttcctggccgcaagcgacgcg
cgccggtgcgacgtcaacgcagccgggcgagttttaccgatctgtgttccgcggcccggc
cgcggctgagtcttcccagggtcagggtcaggcgctttgctgagtccctttgtggccgcc
ATGGACAATTCCGGGAAGGAAGCGGAGGCGATGGCGCTGTTGGCCGAGGCGGAGCGCAAA
GTGAAGAACTCGCAGTCCTTCTTCTCTGGCCTCTTTGG
gtgagaaccgggctgaggggtcggccgggacctaggctgagaggacgaaggagtcacgct
cggaggtggcgggttagggcacgcagagctcgggccgaggggacggagaggaacctgcaa
taaggtgacatggcctgaggcggcagaggggacgcaggctgagggccaagagcctgggcc

 1.02 Intr +  12709  12788   80  1  2   96   68    73 0.361   5.79
tgagtgtgccattgtatgcaggggcgggggccacagactcaagaggcctgggggaagctg
gcttcacaggtgaagggtgaggggtaggggcacgtctgtgcccggcactggagcagaatg
cttgctttctcctggatagccgactagattgtctcctttttttctttcctttttccccag
AGGCTCATCCAAAATAGAGGAAGCATGCGAAATCTACGCCAGAGCAGCAAACATGTTCAA
AATGGCCAAAAACTGGAGTG
gtatgtcatctccgctagagctcctccaaggtgctctcctcctccctcagcttccactca
cacaggcctgcccgagaggttggccttgagggccctttctctttgtatgccctctccggc
atcggaaagccactggcctgctctcttgttttgtgcctgctgggttactttatactctgg

 1.03 Term +  15462  15691  230  1  2  101   44   286 0.917  22.62
ggagccaggagacctgagttctaggcctcggtctgggctcgctcaggtcaccctcgtcct
gtcttggggactctttccgcattctcgagagcccgacccacctcccagggcagtgtctct
gtggcttcataaagtgtggagccccactgaggccaggactgcccttctcttctgttccag
CTGCTGGAAACGCGTTCTGCCAGGCTGCACAGCTGCACCTGCAGCTCCAGAGCAAGCACG
ACGCAGCCACCTGCTTTGTGGACGCTGGCAACGCATTCAAGAAAGCCGACCCCCAAGGTG
AGGGCCTCTGCGGGCCACACGGGCTGGCTGTCCGGAGCGCCATCCTAGCACCCTGCATTG
ATTCCTCAGGTTTCCTGGCGGCTCTGGTTTTTCCAGTGGCCGACATGTGA
taggctggcaggggcgtgcctgaggcagagtgagcgttgactttagaactggctctcttc
cttccagttggcattcgcgccctgctcaagtctccgcccccctatctaccgtgtcggtgg
tgtcggtgcagctgatcaccccttcccaatcccggagcatttgggagtgggagttccatt

 2.01 Init +  18856  18968  113  0  2   61   77    20 0.245  -2.15
ggtgacctgagataagagtagcagtcatgagtgtgtcagaagctcgtccaggagccagct
gtcccaggtgtctgctggtggcccgccgctttccagacatggaggggacttaaccccgtg
agtccatgttgctgcctggggggtaagctgtctccctgctgctactgcaaggactgtgcc
ATGCTGACGGCGGGTGCTCCAGAGCCAGTGCCAGCAGGCCCAGGTGGCAGCTGCAGATCT
CACTGCTCACTGCGGAGCAGCAGCCTTTGCCGCCTCAGCCCACAGGGTGCCAG
gttggtgtcctgggtgttccggccaggagagtgaaccagtgagcagcccggggcctccat
gtggagactgcagccaggtggggcggggcaaggcgggcctctcacctcactccagctgct
gctctcctctgcagcgtggcccggcttagccgttgcttctgggtccgccgattacaggat

 2.02 Intr +  19913  20136  224  2  2   68   75    93 0.689   4.30
tcttaaaaaataccccctgagagctcatttctgtctgctagaaaatgcctcccactcatg
cttttctctctcctccaaataacttgtcaaaaaaaagcctttcccaaatttaaaatcttg
caagagatagtacaacaaaggtagcccagttcttcctcagtgccatcctggtgtgttcag
GTTTTTTGGCAAAACCTTTGAGGAGCTGGTGGGTGGCAGGACTAGGTTAAAGGGACTGAG
CAGAGGGCTCCCGACTGCTGAGCTACGAGGAAGAGGGGGCAGTGGAGAGCACACTGAGGG
CTCAGTGTTGATGACATCCAGCCTCCTCGTGCCAGAGGTCCAGGTCCTCCTGGTGCAGGA
GCAGAAGCTGCTCAGGATCCTGCAGAGATGGTGGCAGAGCCCAG
gtagaacctggcaccctgttgcctccaagaccacctcagatgctggtttggccgcctccc
atgcctccttcccctttgccagcagctcagtccttcaagagcagggccttggcaggtctg
tcttaaaacaccgtgggagtctggccatcatcctggcctagcactgctgtgccctgtccc

 2.03 Intr +  20615  20661   47  0  2  119   91    46 0.565   6.62
ctcagggattccgtccccttcttcccagccccttgagagtgtgtggcagcgctggcagct
ctgagcgcctattgatctctctgctggcagccaggtgcgcctgcgtccgcctcctctcct
cagcttctgctgaaacgacttcactttctcatgtctcctcccacctccctttctctccag
AGGCCATTAACTGTTTGATGCGAGCAATCGAGATCTACACAGACATG
gtaagggctgcttgcttgtcctgacacccccgggtcccactgcattgccccagccttgcg
tcccctctttcagcacccccagcactgttcttattctgcggccaaaccacttggggaggg
ggaagtgggagctggggggattaggtcacctgagctggcctgggctggctgggtcttcac

 2.04 Intr +  22718  22795   78  1  0   88  113   147 0.996  17.44
tggggccctcccttctcactcctgtgttcccccacctctcgatcttcttcacacctcagg
tcttcttcatacctcctcacaggcgtggctgaggggtgggaacttgaagggtcataggtc
agcaggcaggcacgcaggaggtcatgagtcgcaggcagccccttcctgtgtcccctccag
GGCCGATTCACGATTGCGGCCAAGCACCACATCTCCATTGCTGAGATCTATGAGACAGAG
TTGGTGGACATCGAGAAG
gtgagtggcagcagggccctgcatgggctggcagccaggaccagtgctgctctctcttct
tcccaccaggggagtcctctggtgtctgagtgccgagaagggggcatggggcgccggcag
agcttggagaatggggtctggctgtgtcccaggcaggcagggcggagggtgtggaagctt

 2.05 Intr +  23037  23092   56  2  2  113   68   148 0.999  13.57
cccaccaggggagtcctctggtgtctgagtgccgagaagggggcatggggcgccggcaga
gcttggagaatggggtctggctgtgtcccaggcaggcagggcggagggtgtggaagcttc
acggaggcctcctctcccttccctgccctcccctggaacccatcccccgtgtctccccag
GCCATTGCCCACTACGAGCAGTCTGCAGACTACTACAAAGGCGAGGAGTCCAACAG
gtagcccccttcctgcctgccccagccccgcagggaccgccaccacttcccctcactact
cctccccacacagctcagccaacaagtgtctgctgaaggtggctggttacgctgcgctgc
tggagcagtatcagaaggccattgacatctacgaacaggtggggacaggtggggatggcg

 2.06 Intr +  23166  23250   85  0  1   91   75   205 0.966  19.82
tcctctcccttccctgccctcccctggaacccatcccccgtgtctccccaggccattgcc
cactacgagcagtctgcagactactacaaaggcgaggagtccaacaggtagcccccttcc
tgcctgccccagccccgcagggaccgccaccacttcccctcactactcctccccacacag
CTCAGCCAACAAGTGTCTGCTGAAGGTGGCTGGTTACGCTGCGCTGCTGGAGCAGTATCA
GAAGGCCATTGACATCTACGAACAG
gtggggacaggtggggatggcggcttccaccctgccccctctcagggcctgtgcctcctc
ctaagccccggcaccttgttctggaaccacccctcccccggctcaccctctgcctctccc
ccgacatcccttgccatgtcatccccccaccctgtcttcagcctggctgaatgttctcca

 2.07 Intr +  23831  24196  366  1  0   94   64   337 0.464  27.80
tccccccagcgtgcacggagccctgggtgatggccgagaaaaaggcaggcagctggcccc
ctgggagagaggggcgggcgccgcctctcatgttcccaccgcctgccgccgctctgccca
ccgccatgccagcctcccgttggtcctgacagccaggctgcctccttcccactgtctcag
GCTCTCAGAAGGCCCACGAACACCTGGCTACAGCCTCCACCCCCACCCAGCCACCATCAC
ACCCTGATCTTGGTCGCTCACGCACTGGCCGCTGACCTCTCCAAGCTGGTCCCTGGCTCC
CTGCCCTTGGGGTCCTGGGTTAACAGGGCCTCACCTCGGGACATGAACCAGCTCCCAGCT
GGCCCCCCAGTGCCTGGCAGTGGCTCTGGCCCTCTGGCTGCTTGCCCTGAGCTCACCAGT
GCCACTTCTCCATGGCTACAGGTGGGGACCAATGCCATGGACAGCCCCCTCCTCAAGTAC
AGCGCCAAAGACTACTTCTTCAAGGCGGCCCTCTGCCACTTCTGCATCGACATGCTCAAC
GCCAAG
gtagcacaccccacgcccgcaggaccaccgcaccaggccaccatgtgcttatctccaggc
caggtcccgttgcccccgaagagggacgtgctcctccctcacgtctggcccctgccagcc
agcctttggatgagaagtgtggttctcacagctgtgtttctgtgctggcatcacctgccc

 2.08 Intr +  25355  25423   69  1  0  100  106    68 0.997   9.67
ctgagctcagctacgggaaggtactgacagacacagagccaggtgacacctgaggctggg
ggaggggtgcaagagctgactcaatatcacccgacatccccaagtcccctcagctgctag
gccagtagctctgaggaccctcttgttactaactcatcttctcccttccctgctgcccag
CTGGCTGTCCAAAAGTATGAGGAGCTGTTCCCAGCTTTCTCTGATTCCCGGGAATGCAAG
TTGATGAAA
gtaagtgctgggtgctccggcctcccccttcccgaacctcagacgggggtggctggggct
ccaggtgggacaatcgccaagacttgtccagtagttctcagagggtgtctttgttttgtt
ttgttttgttttgttttgtttggccatttgagtctccattttccagatgaagaaagtaca

 2.09 Intr +  26450  26500   51  1  0  114  109   125 0.979  16.79
agcaggatcgcaacacgcccgtacccatccccagtttaacccacacggattgaccctctg
agagtcctcaggaagccccagccccaggcctggcatacagatagcgtgtcctttcatcta
atccaggccagacctcaggtcagcataggcccctgacccctctctgccatttgcttgcag
AAATTGCTAGAGGCCCACGAGGAGCAGAATGTGGACAGCTACACCGAGTCG
gtgagtggccagcatggggggccaggccccttcacggggatgggtctcctaggaaagctg
cccttctcagacacgctctccatgacattcacccatttcatctggcccccagcccactgt
gaagttctttctccagtcaccccagaaaccttacaagtagcgccaagaggcgcagggagt

 2.10 Term +  27822  27923  102  2  0   92   46   251 0.999  19.88
gtcaagacagacaagagggagctcccatggctgagttggggcctcaagccctccctctac
tcctcctcagagaccaggggtgacagagacagatcttgaaaaccttgggacaagtgccct
tgggctgcagggttgggaacggggggagcatggccagcctatcacctggtgtgccctcag
GTGAAGGAATACGACTCCATCTCCCGGCTGGACCAGTGGCTCACCACCATGCTGCTGCGC
ATCAAGAAGACCATCCAGGGCGATGAGGAGGACCTGCGCTAA
gccccacccagccccccagtgcccgtcttcctgtcccatctgctcagagagaggtggggc
cgagacttgctggagagcttccctcctttcccatctggggagtgccgcgggccacagtgg
gcaggtggcaccgggggtcagcatgcaggggcgccagaggcccaggctgctggccggaca

Predicted peptide sequence(s):


>NAPA_1|GENSCAN_predicted_peptide_1|135_aa
MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQGEGLCGPHGLAVRSAILAPCID
SSGFLAALVFPVADM

>NAPA_1|GENSCAN_predicted_peptide_2|396_aa
MLTAGAPEPVPAGPGGSCRSHCSLRSSSLCRLSPQGARFFGKTFEELVGGRTRLKGLSRG
LPTAELRGRGGSGEHTEGSVLMTSSLLVPEVQVLLVQEQKLLRILQRWWQSPEAINCLMR
AIEIYTDMGRFTIAAKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLL
KVAGYAALLEQYQKAIDIYEQALRRPTNTWLQPPPPPSHHHTLILVAHALAADLSKLVPG
SLPLGSWVNRASPRDMNQLPAGPPVPGSGSGPLAACPELTSATSPWLQVGTNAMDSPLLK
YSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSY
TESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR