GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:49:18

Sequence KLK9_1 : 9521 bp : 51.58% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1288   1330   43  0  1   85   94   133 0.939  12.12
cttacctcctctcccaaggcccctgtcacagccccagggcttccccctcccccaggtaca
tttcccaaccccgattaatcacaggggcggccccatggaggaggaaggagatggcatggc
ttaccataaagaagcactggacgccgggtgcacgttccaggatccaggtgcccaggggtc
ATGAAGCTGGGACTCCTCTGTGCTCTGCTCTCTCTGCTGGCAG
gtgaggctcccaggctggctgccccttcacggctgtactaaggtcaccttgctcttccct
cccatcccaggcttctgcctcctgccctctaggcttctcagcatcctctccctgccctcc
cagcctgctcttcgctgacccctttgtccctcatccccaccccagggcatggctgggcag

 1.02 Intr +   1496   1652  157  0  1  117   78   148 0.904  16.28
tctctctgctggcaggtgaggctcccaggctggctgccccttcacggctgtactaaggtc
accttgctcttccctcccatcccaggcttctgcctcctgccctctaggcttctcagcatc
ctctccctgccctcccagcctgctcttcgctgacccctttgtccctcatccccaccccag
GGCATGGCTGGGCAGACACCCGTGCCATCGGGGCCGAGGAATGTCGCCCCAACTCCCAGC
CTTGGCAGGCCGGCCTCTTCCACCTTACTCGGCTCTTCTGTGGGGCGACCCTCATCAGTG
ACCGCTGGCTGCTCACAGCTGCCCACTGCCGCAAGCC
gtgagtgacccaggctggccatgctggggagggacagaggctgggggtcaggagagggtg
aggggtgctttaggccagaagtgcggagcctccacttctgataccacaagttcaactctt
agaagtaggaagggtagcctcccaaatcctaaaattctagagaccagcaatatctcattt

 1.03 Intr +   4112   4377  266  2  2   70   55   170 0.912   9.59
ggaggtgtgtgcctcgcttaaaatcacagtaccctgggccagacatagatgatgagggtg
cagagagggtgtgtggcttgcagagggtcacacagcaccctgatggacaggaaaagaggg
ctggggctgaaaggacttttacctttcccccagcttgacctctgaggcctgtcccagcag
GTATCTGTGGGTCCGCCTTGGAGAGCACCACCTCTGGAAATGGGAGGGTCCGGAGCAGCT
GTTCCGGGTTACGGACTTCTTCCCCCACCCTGGCTTCAACAAGGACCTCAGCGCCAATGA
CCACAATGATGACATCATGCTGATCCGCCTGCCCAGGCAGGCACGTCTGAGTCCTGCTGT
GCAGCCCCTCAACCTCAGCCAGACCTGTGTCTCCCCAGGCATGCAGTGTCTCATCTCAGG
CTGGGGGGCCGTGTCCAGCCCCAAGG
gtatgacctggcccagaactctctctgaaacttgctccctcacccctctgtctctgcctt
ttcatctctgtcttctccttttctctctcctctctctctctgtcagtctatctatctgcc
aatcgatatatttaaccaaatataagatgctagcatttttaagatgtgccattatttcat

 1.04 Intr +   6995   7131  137  0  2   79   94    61 0.932   6.60
catttgtttctcttgtgtgctatgactgtctgtctgtcactgtctcttgtctctatcttt
gagagtcctaaatgtggctccattggtcctttggaaaagctgcagggaggactcagggca
gtggggtgctgagtgtgttggagacagttgcagatccttgacagttctcttccctgacag
CGCTGTTTCCAGTCACACTGCAGTGTGCCAACATCAGCATCCTGGAGAACAAACTCTGTC
ACTGGGCATACCCTGGACACATCTCGGACAGCATGCTCTGTGCGGGCCTGTGGGAGGGGG
GCCGAGGTTCCTGCCAG
gtgagaccttactctggggaaaatgaggctgtcctgccaagttttctaggatttagggga
gcagaggggtcggcccccagccttcctgggtcaaaatgagaaggagactgggatacctgg
ttcctgggagaggacgggaccagggcctggactccttagtgtaaaagagaaaaggtctgg

 1.05 Term +   7575   7724  150  2  0  112   52    76 0.959   4.62
ggggaggtgggccctctgagcttttactcctgggtctgaggaagaagaggctggagatgg
aggactctcggatgttggaggaggaaggggctggggcctttctgggagggaggaagtggc
ccgtgtaattgtcatgaacagagtggcctaacagttcctctgcccttctctcgcgtacag
GGTGACTCTGGGGGCCCCCTGGTTTGCAATGGAACCTTGGCAGGCGTGGTGTCTGGGGGT
GCTGAGCCCTGCTCCAGACCCCGGCGCCCCGCAGTCTACACCAGCGTATGCCACTACCTT
GACTGGATCCAAGAAATCATGGAGAACTGA
gcccgcgcgccacgggggcaccttggaagaccaagagaggccgaagggcacggggtaggg
ggttctcgtagggtcccagcctcaatggttcccgccctggacctccagctgccctgactc
ccctctggacactaagactccgcccctgaggctccgccccctcacgaggtcaagcaagac

Predicted peptide sequence(s):


>KLK9_1|GENSCAN_predicted_peptide_1|250_aa
MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLT
AAHCRKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQ
ARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYP
GHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHY
LDWIQEIMEN