GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:09:52

Sequence KLF1_1 : 4718 bp : 58.20% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1264   1350   87  0  0  104   81   141 0.842  14.09
tgaagtttgtgccccagaaacagtgcccccccgccgccttgccttgctttgccttatcag
aggctgcagccaatcagctaaggacagagaggagccctcgaaggggctatcacagcctca
gagttcacgaggcagccgaggaagaggaggcttgaggcccagggtgggcaccagccagcc
ATGGCCACAGCCGAGACCGCCTTGCCCTCCATCAGCACACTGACCGCCCTGGGCCCCTTC
CCGGACACACAGGATGACTTCCTCAAG
gtggggcctagaaggtggggtctaggtgggctggctggaatccagggccacagtcacaga
tcttggggtccagacctgcatcttgacctgaaatcaagagacttaaccaggactgaggta
cgctcagtccaggagaggagatctcagcttagtctggcagggggtgaggagggtggtcta

 1.02 Intr +   2262   3087  826  2  1   84   94   721 0.844  64.82
agctggggggggagcggggagaggggcggttagaggggcagtgttggggaagtgggacag
acagacaggcaaacaagacccctttccaaagcctctgcgtcagagtgtccagcccgcgat
gtccctgggcagggcaccccagtgtccaccgaacctcgagctgcctgctccctcccgcag
TGGTGGCGCTCCGAAGAGGCGCAGGACATGGGCCCGGGTCCTCCTGACCCCACGGAGCCG
CCCCTCCACGTGAAGTCTGAGGACCAGCCCGGGGAGGAAGAGGACGATGAGAGGGGCGCG
GACGCCACCTGGGACCTGGATCTCCTCCTCACCAACTTCTCGGGCCCGGAGCCCGGTGGC
GCGCCCCAGACCTGCGCTCTGGCGCCCAGCGAGGCCTCCGGGGCGCAATATCCGCCGCCG
CCCGAGACTCTGGGCGCATATGCTGGCGGCCCGGGGCTGGTGGCTGGGCTTTTGGGTTCG
GAGGATCACTCGGGTTGGGTGCGCCCTGCCCTGCGAGCCCGGGCTCCCGACGCCTTCGTG
GGCCCAGCCCTGGCTCCAGCCCCGGCCCCCGAGCCCAAGGCGCTGGCGCTGCAACCGGTG
TACCCGGGGCCCGGCGCCGGCTCCTCGGGTGGCTACTTCCCGCGGACCGGGCTTTCAGTG
CCTGCGGCGTCGGGCGCCCCCTACGGGCTACTGTCCGGGTACCCCGCGATGTACCCGGCG
CCTCAGTACCAAGGGCACTTCCAGCTCTTCCGCGGGCTCCAGGGACCCGCGCCCGGTCCC
GCCACGTCCCCCTCCTTCCTGAGTTGTTTGGGACCCGGGACGGTGGGCACTGGACTCGGG
GGGACTGCAGAGGATCCAGGTGTGATAGCCGAGACCGCGCCATCCAAGCGAGGCCGACGT
TCGTGGGCGCGCAAGAGGCAGGCAGCGCACACGTGCGCGCACCCGGGTTGCGGCAAGAGC
TACACCAAGAGCTCCCACCTGAAGGCGCATCTGCGCACGCACACAG
gtgagggggcggggccccggacatgagaaagggcgcggcgcccgctgtagttacagggga
agaagggttgcagagggcgggacttggacttggctggcctctgagagtgagtgcctcctt
aaattttgtgccctaggggcctcactttgttcatcctagtcccagcccaggctgagtaaa

 1.03 Term +   3344   3519  176  0  2   98   52   174 0.948  13.68
gcgggacttggacttggctggcctctgagagtgagtgcctccttaaattttgtgccctag
gggcctcactttgttcatcctagtcccagcccaggctgagtaaaggggtgtggccagatg
caggggacccggggacatgactgggcagacagtggcgcttatggcttccttgtcccctag
GGGAGAAGCCATACGCCTGCACGTGGGAAGGCTGCGGCTGGAGATTCGCGCGCTCGGACG
AGCTGACCCGCCACTACCGGAAACACACGGGGCAGCGCCCCTTCCGCTGCCAGCTCTGCC
CACGTGCTTTTTCGCGCTCTGACCACCTGGCCTTGCACATGAAGCGCCACCTTTGA
gccctgccctggcacttggactctcctagtgactggggatgggacaagaagcctgtttgg
tggtctcttcacacggacgcgcgtgacacaatgctgggtggttttcccacgaatggaccc
tctcctggactcgcgttcccaaagatccacccaaatatcaaacacggacccatagacagc

Predicted peptide sequence(s):


>KLF1_1|GENSCAN_predicted_peptide_1|362_aa
MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPG
EEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGP
GLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGG
YFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLG
PGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHL
RTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKR
HL