GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:42:35

Sequence IRF3_1 : 8496 bp : 57.69% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1071   1197  127  2  1   36   47   119 0.775   4.03
cgcctgcgcactgggccgggtcgataaccggcccagcgtagaaagggcggaacgctgggt
gcacgctcaatttgcatgtgacgctcccagcatgcctctggccggaaacccaaaaaaggg
cataggggcgggaacagcccagcgggccgtcccatcggcttttgggtctgttacccaaag
AATGATAAAGTTGGTTTTATTTCAAGAAGTCGATCAAAAAGAAAGCCCCAGCGCTCTAGA
GCTCAGCTGACGGGAAAGGGGGTGCGCAGCCTCGAGTTTGAGAGCTACCCGGAGCTCCAA
GACAGGG
gtgggttccagctgcccgcacgccccgaccttccatcgtaggtaacgcggaagagcccgg
gagagcgttggtggcgtccgagagcgaggagcgggaaagaggatgggtctgcacggagag
tggaaaggcaggctgtgtactctggggaaagtggagcaaggaaggagctacagtggccga

 1.02 Intr +   1239   1385  147  1  0   75   41   104 0.123   5.79
tgttacccaaagaatgataaagttggttttatttcaagaagtcgatcaaaaagaaagccc
cagcgctctagagctcagctgacgggaaagggggtgcgcagcctcgagtttgagagctac
ccggagctccaagacaggggtgggttccagctgcccgcacgccccgaccttccatcgtag
GTAACGCGGAAGAGCCCGGGAGAGCGTTGGTGGCGTCCGAGAGCGAGGAGCGGGAAAGAG
GATGGGTCTGCACGGAGAGTGGAAAGGCAGGCTGTGTACTCTGGGGAAAGTGGAGCAAGG
AAGGAGCTACAGTGGCCGACGCTGGAG
gtcggctgcagaaaaactagaaaaagtagggaggaaagaggaaaagaggaggcgtctaca
ctgagggggttctagagagggaggggtggactccgtagatgggggtagttcagtctcgaa
acctggggcgtgctctgtcctggaggagggaggcgggcagtcggaggggaattgaatgga

 1.03 Intr +   2023   2195  173  2  2   26   96   263 0.123  21.76
ttagagagcctctcgggaggatgggaggatgggaagaggaggtttcctgtttgtaccccc
gaaaatatgggtgaaggacctgtgccgtggcccgtgagaaggaggtctgggtgcggaaac
tccaggccaggtgggtccgggggaggccggtcgcgcccaggaaatgccctatacgcgcag
GCCGGACCATGGGAACCCCAAAGCCACGGATCCTGCCCTGGCTGGTGTCGCAGCTGGACC
TGGGGCAACTGGAGGGCGTGGCCTGGGTGAACAAGAGCCGCACGCGCTTCCGCATCCCTT
GGAAGCACGGCCTACGGCAGGATGCACAGCAGGAGGATTTCGGAATCTTCCAG
gtgcgtgcgacgacctgggacgctggaaacccggagctgcgcgctgggcggaaaggactc
ctagtgggcccggctgagaaggcggaggtggcgcgcgaggggcgggctcgtgccaacgct
ggtgggtggggctagaacgggaggggcggggctagccggatccgctgactgatggtgggg

 1.04 Intr +   3355   3526  172  0  1   77   46   206 0.950  16.02
ttgaaaactagaggtgggggatggaggtaggtgggacggggggatttggggatggacctt
gcagagttagaacttgccagggaaagagggtggtgttaggactcgggagacagggttagg
gccccaggagcaggatctaagtcgtcctcccccaccatcctgacaccactgttgccccag
GCCTGGGCCGAGGCCACTGGTGCATATGTTCCCGGGAGGGATAAGCCAGACCTGCCAACC
TGGAAGAGGAATTTCCGCTCTGCCCTCAACCGCAAAGAAGGGTTGCGTTTAGCAGAGGAC
CGGAGCAAGGACCCTCACGACCCACATAAAATCTACGAGTTTGTGAACTCAG
gtctgccagcttggggttcgtgtgggaggctggggccccaagggttcctggcactcctac
tcccctcaccacttttctcaacaggagttggggacttttcccagccagacacctctccgg
acaccaatggtggaggcagtacttctgatacccaggtgagaatgtgcccaactttcatgc

 1.05 Intr +   3611   3681   71  0  2   90   94    51 0.957   5.95
gctctgccctcaaccgcaaagaagggttgcgtttagcagaggaccggagcaaggaccctc
acgacccacataaaatctacgagtttgtgaactcaggtctgccagcttggggttcgtgtg
ggaggctggggccccaagggttcctggcactcctactcccctcaccacttttctcaacag
GAGTTGGGGACTTTTCCCAGCCAGACACCTCTCCGGACACCAATGGTGGAGGCAGTACTT
CTGATACCCAG
gtgagaatgtgcccaactttcatgcccctcagtctccgacctgtctccatgggccttgtc
ctctccctctagacgatccccccactcccctgcctccagcctgcccctcacctgagccag
tgctgaccctgtctgtccctgccccggtctcctcaggagaaaattccaagtcttcaccca

 1.06 Intr +   4252   4444  193  0  1  122  113   110 0.965  17.18
cgttcattagtgtttgtttggctgttgatgccatggctggctctgtccccaggctggaag
ccccttgaaggcagagctcaagcctgacctccctgcgttgctgagaacagacctggtcca
tatgaagtctccagaaaaggatatggaaatgcctgattctctttttttgtttccctccag
GAAGACATTCTGGATGAGTTACTGGGTAACATGGTGTTGGCCCCACTCCCAGATCCGGGA
CCCCCAAGCCTGGCTGTAGCCCCTGAGCCCTGCCCTCAGCCCCTGCGGAGCCCCAGCTTG
GACAATCCCACTCCCTTCCCAAACCTGGGGCCCTCTGAGAACCCACTGAAGCGGCTGTTG
GTGCCGGGGGAAG
gtgagtgtcagctgcaggctgggagggctgaggtctgggcggcagcccctgattctcaac
ccctctccccttcatgccgctgctgccgctgctcagagtgggagttcgaggtgacagcct
tctaccggggccgccaagtcttccagcagaccatctcctgcccggagggcctgcggctgg

 1.07 Intr +   4541   4921  381  0  0   66   95   294 0.705  24.09
gccccagcttggacaatcccactcccttcccaaacctggggccctctgagaacccactga
agcggctgttggtgccgggggaaggtgagtgtcagctgcaggctgggagggctgaggtct
gggcggcagcccctgattctcaacccctctccccttcatgccgctgctgccgctgctcag
AGTGGGAGTTCGAGGTGACAGCCTTCTACCGGGGCCGCCAAGTCTTCCAGCAGACCATCT
CCTGCCCGGAGGGCCTGCGGCTGGTGGGGTCCGAAGTGGGAGACAGGACGCTGCCTGGAT
GGCCAGTCACACTGCCAGACCCTGGCATGTCCCTGACAGACAGGGGAGTGATGAGCTACG
TGAGGCATGTGCTGAGCTGCCTGGGTGGGGGACTGGCTCTCTGGCGGGCCGGGCAGTGGC
TCTGGGCCCAGCGGCTGGGGCACTGCCACACATACTGGGCAGTGAGCGAGGAGCTGCTCC
CCAACAGCGGGCATGGGCCTGATGGCGAGGTCCCCAAGGACAAGGAAGGAGGCGTGTTTG
ACCTGGGGCCCTTCATTGTAG
gtgagtgagacaggggcttcgacctggccagtacaaagcagcctgcacagtggttaacaa
ctcaggattggccgggcacggtggctcacgcctgtagtcccagcactttgggaggctgag
gtgggcagatgacaagttcaggagttcgagaccagcctggtcaacatagtgaaaccccat

 1.08 Intr +   6041   6156  116  0  2   70   46    48 0.846   0.14
accctgatgggagggagggagggagggaaggaggggactttccccaaacaagcagtcccc
tggtcgaggcagcagagggccttaggtcaggggaggtggtgggggttatcattcaagttt
acggggaagggtgggtagagggtcctcttctcatccctgactaggctcctgggcccccag
ATCTGATTACCTTCACGGAAGGAAGCGGACGCTCACCACGCTATGCCCTCTGGTTCTGTG
TGGGGGAGTCATGGCCCCAGGACCAGCCGTGGACCAAGAGGCTCGTGATGGTCAAG
gtgcctgcagacctgagtccctggggctgaaaggggtggccttacagagggaagaggttg
ctcccaggaactccaactcccagagggccctctaaaaaactgcaacttccaagatctctg
caataaccagtttttcatccccgggagctccttcccatggcctcacctgcagaacctgtt

 1.09 Term +   7036   7221  186  0  0  142   52   188 0.998  19.06
tgtgtgtgtgtgtgtgtgtgtgtgtgtgtaaaactacaactcccagcagccctaggccta
tggttcatcctaggttacagcaggggctgcagggagttgtagtcctccaagccctgactc
ctaccttggtggacagtggctgggtgttttccctgactcctgtccccacttcccctgcag
GTTGTGCCCACGTGCCTCAGGGCCTTGGTAGAAATGGCCCGGGTAGGGGGTGCCTCCTCC
CTGGAGAATACTGTGGACCTGCACATTTCCAACAGCCACCCACTCTCCCTCACCTCCGAC
CAGTACAAGGCCTACCTGCAGGACTTGGTGGAGGGCATGGATTTCCAGGGCCCTGGGGAG
AGCTGA
gccctcgctcctcatggtgtgcctccaacccccctgttccccaccacctcaaccaataaa
ctggttcctgctatgatcacttgtgcgtgtctggtgttgggtgccctctgacccaatatg
gttgttattcccgctcagggtctcagtttacccatctgtgcagctatatacaactcaggt

Predicted peptide sequence(s):


>IRF3_1|GENSCAN_predicted_peptide_1|521_aa
NDKVGFISRSRSKRKPQRSRAQLTGKGVRSLEFESYPELQDRGNAEEPGRALVASESEER
ERGWVCTESGKAGCVLWGKWSKEGATVADAGGRTMGTPKPRILPWLVSQLDLGQLEGVAW
VNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNR
KEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGN
MVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEV
TAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLS
CLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFI
VDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASS
LENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES