GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:30:18

Sequence INSL3_1 : 7052 bp : 52.00% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1390  190  0  1  108   84   291 0.970  27.85
ctgggagaagtacatccaaggccctggccctgggagaaaggctctggcactaaccccacc
cttgacctttttcctgggcggtcctgaagaatgttctgtcccttctccaaggcccccagc
tgggacggcccaggcgcctataaagggggtccccgcttggccccggcgccacccaccacc
ATGGACCCCCGTCTGCCCGCCTGGGCGCTGGTGCTGCTGGGCCCTGCCCTGGTGTTCGCG
TTGGGCCCCGCGCCCACCCCAGAGATGCGTGAGAAGTTGTGCGGCCACCACTTCGTACGC
GCGCTAGTGCGCGTGTGCGGGGGCCCCCGCTGGTCCACCGAAGCCAGGAGGCCTGCGACC
GGAGGCGACC
gtgagtggggacgggcagggacagcgctctgggaagccgaggtggggcaggtgcacgtag
gcgcagatgcacacgtgcagggaggtgggcaggtttgcatgcatgtgcccagggctcacc
tgccggctgcgtgcacagatcgtgggtccgcactggagtgtgtgtgaacgcgcgtgtgaa

 1.02 Term +   5648   5853  206  0  2   88   37   167 0.986   9.46
tcccaaagtgctgggattacaggtgtaagccactgcacccggccagtgctcactttttat
ctgcatgcatgagtgtttggtgggttactcagtgggatgtgtgtggattcgtgcacatgc
agcatggggtagcatgtcctctgtcgtttccgttccagctgagtttcactctgtccccag
GTGAGTTGCTACAGTGGCTGGAGAGACGACATCTGCTCCATGGGCTGGTGGCCGACAGTA
ATCTCACGCTGGGACCTGGCCTGCAGCCCCTGCCCCAGACCTCTCACCATCACCGCCACC
ACCGTGCAGCTGCCACCAACCCTGCACGCTACTGCTGCCTCAGTGGCTGTACCCAACAAG
ACCTGCTGACCCTCTGTCCCTACTGA
ttcctccttgggtgcagcctcagagtggcctgaggcccagagggtctggtctggtgagct
cctgaggccacacagcaccataaagtctcgcatctacaggcctttgattacctcctggga
tgggtgctcactatctaccccagaccaatgccacctgcagcctgtggagtcaactgcaga

Predicted peptide sequence(s):


>INSL3_1|GENSCAN_predicted_peptide_1|131_aa
MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAT
GGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGC
TQQDLLTLCPY