GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:31:40

Sequence IL12RB1_1 : 29726 bp : 51.44% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    265    272    8  0  2  103   66    11 0.507   0.05
gggattagaggggtgagcccaggtgcacaaggctggagcttggcatgtggggaggtgggc
attgtggagggccagcatgctgcaagctctttgtaacaatttgttggaaggatgaaatta
ggccatccaagaacactgccctccttcagctcttgagtctcagattcagaagctggcgag
ATGGCCCG
gtgcggtggctcacgcctgtgatcccagaattttggtaggccaaggcggacggatcattt
gaacccgggagtttgagaccagcctgggcaacatggcaaaaccccctctcttaaaaaaaa
aaaaatgcaaaaattagctgggcgtggtggtgcatgcctgtagtcccagttcctggggag

 1.02 Intr +   1156   1328  173  1  2  120  101    98 0.973  14.40
gccagcagggcagaaccccctagaaccctgacttgctccaaagtcagacttgctccagag
tctgtggccgccaccatcaccaccaccacggagctgacttcctgggtttctctttcactt
tgacttgccttagggatgggctgtgacactttactttttttcttttttcttttttttcag
TCTTTTCTCCTTGCTCAGCTTCAATGTGTTCCGGAGTGGGGACGGGGTGGCTGAACCTCG
CAGGTGGCAGAGAGGCTCCCCTGGGGCTGTGGGGCTCTACGTGGATCCGATGGAGCCGCT
GGTGACCTGGGTGGTCCCCCTCCTCTTCCTCTTCCTGCTGTCCAGGCAGGGCG
gtgagtcccctgaccctggcatggcggctcctcttgctgggtggaggcacgtgtatgtgt
ggagagctgtgggcctgctgtgtgggttggtttcatctctctgtgcctcagtctttcctg
ctgtcaaatgggagatgggcagtcatggcttctgggatcgaacttagacatctttcctct

 1.03 Intr +   4555   4656  102  2  0   71   52    53 0.383   0.65
gggtagatggtggacggatgaataaatacatggatggatgggtagatgggcagataaata
catgggcagatggatggatgggtggtggtaggagggtgcatagatgggaaagtgggtggg
tgggagggctgatgatcacttgggtgtagaccccaaggctgagcccttctccccacacag
TGCAAGGCCAGGAATGTCATTATGTCTTCATTGCCTTTGCAGCTGCCTGCAGAACCAGTG
AGTGCTGTTTTCAGGACCCGCCATATCCGGATGCAGACTCAG
gttcggggcagttcctcattgttggctgaggattatgtagggctctgcctgaccccatcc
acagcggcccctcccatggcctccaccaccaggccaaagacccagccctgcctgtggtct
tgggagtccccaccccaccacctgctggcccattcttaccaggttcaagttgccctggag

 1.04 Intr +   5812   5938  127  2  1   37   73    83 0.771   1.94
tgaggacaagttaggaggctgaggattcggaataggttgaggtgagagacggcaggggat
gaggtaggaaggacgcggggagggtttaggctgaggtgacgctgaaagatgtaagcatca
caaagatttgtcttaggcacgaagacccctccagactctggtctgttcccaagcctacag
GATCTCTTCCAGGCTCGGCCTCGGGCCCTAGGGACCTGAGATGCTATCGGATATCCAGTG
ATCGTTACGAGTGCTCCTGGCAGTATGAGGGTCCCACAGCTGGGGTCAGCCACTTCCTGC
GGTGTTG
gtgaggacccctctaccattcccaaaccctcacccaccatcccactcttgcttcaacccc
ctctggtgcccctactctcggatgcgtgatcttggctgggtcaacactccttcctgggct
tcagtttctcatctaagaagagagagttggaggattgtggtggggggttggtcagtgaag

 1.05 Intr +   7087   7256  170  1  2  106   71   140 0.995  14.21
ggaggttgcagtgagccgagattgcgcgactgcactccagcctgggtgacagaatgaaac
tccatctccaaacaaacaaacaaacaccaaaaaaacgatgctgggatgtgatgcacaaag
tcggctgtggggtccactaggaccccagactcggcactgacaccctccttcctgctgcag
CCTTAGCTCCGGGCGCTGCTGCTACTTCGCCGCCGGCTCAGCCACCAGGCTGCAGTTCTC
CGACCAGGCTGGGGTGTCTGTGCTGTACACTGTCACACTCTGGGTGGAATCCTGGGCCAG
GAACCAGACAGAGAAGTCTCCTGAGGTGACCCTGCAGCTCTACAACTCAG
gttagcaccttgttctccccccgtccgttttttacccagagaggccatcaggctgcaagg
ctggagctagagaggattcctggcccttggcaagggacttgatactactagccattgtca
cttcacgtagtgtcacgcaaacactattgtgacaaagcagtctttcatggtccccttacc

 1.06 Intr +  10433  10572  140  0  2   90   97   187 0.999  20.49
ggcttgtgtataaatcttgactttttgatcataatataccaggcttagctgggacctgca
agtgtcccctaattcatatttagggattcagttgcttaccctggacagggtggattttca
gggcccattaactcacatacgtgtgggctgcccctcgccaatccctacctctgcttccag
TTAAATATGAGCCTCCTCTGGGAGACATCAAGGTGTCCAAGTTGGCCGGGCAGCTGCGTA
TGGAGTGGGAGACCCCGGATAACCAGGTTGGTGCTGAGGTGCAGTTCCGGCACCGGACAC
CCAGCAGCCCATGGAAGTTG
gtgagtttgtttcccaagtccagggtggacacgggcctctccagggcaccttcaccccca
aatcagtctcaccatctctgcatctgtccccgctcccaaccagcccccactctagcccct
gaggtggtttttttctttttctttttttttttctgagacggagccttgctctgtcgccca

 1.07 Intr +  11761  11938  178  0  1   61   75   100 0.852   6.01
cacctgagccctgggaggttgaggcttcaataagccatgattgcaccactgcactccagc
ctagatgacagagtgagaccgtgtctcagataaataagtaaataaataactaattgtaaa
acagcaaatatttttcagcaccaaaatgcaaaacaatatatgaatatgtttttattctag
GGCGACTGCGGACCTCAGGATGATGATACTGGTGAGAATAATAATAGTAATGACAACAAC
AGCTGCAGCAAATTGGCATTAATTGAGCACCTACTGTATGCCAGGTCCAATGCTGAATTT
TTTTGTATGCCTCTTACCCTGCCCCATAGTTCAGTATTGGATTCTTTCCAAATTGCAG
gtggggaaacaaatcacgacttggagggggtgagaagcctttggccaaggtcacgaccga
agggatggccgcagccaggacttgaactgaggggcagggatggacgtgggtgatcctgga
ggccctaagaggacagggcctggcctgcttctgctgagcccccaggacccagcacgtggc

 1.08 Intr +  12220  12339  120  2  0  106   99    92 0.982  13.07
ggacgtgggtgatcctggaggccctaagaggacagggcctggcctgcttctgctgagccc
ccaggacccagcacgtggctctgtacacagttggagctcaataagcacatgatggttaag
tgactggtgccaagtcctggacaattcttacggcctgatgttcgacctgcctctccccag
AGTCCTGCCTCTGCCCCCTGGAGATGAATGTGGCCCAGGAATTCCAGCTCCGACGACGGC
AGCTGGGGAGCCAAGGAAGTTCCTGGAGCAAGTGGAGCAGCCCCGTGTGCGTTCCCCCTG

gtaagatcactctgagtacaggaacaggggcaagcattagaaataaggcaacagccggag
gtggtggtgcacacctgtagttccagctgctcagaaggctgaggcgggaggatcacttga
ggccagtggtttgagaccagcccgggcaacatagtgagaccccatctctaaaaaataaaa

 1.09 Intr +  14468  14571  104  0  2   60   97    61 0.802   4.59
acatgagattacaggtggcagttatccctggggatgcaaattgtgttaatttttcttcct
tcagttttttctcttttctgcaatttggggcagcaagggattttcactttgtaaatgtgg
agaatccatcatttacaaagaaaacatccatcagtctttctctccttccaattcgtctag
TTGGTTTGGTTCTGATTGCAGAAAACCCCCCACAGCCTCAGGTGAGATTCTCGGTGGAGC
AGCTGGGCCAGGATGGGAGGAGGCGGCTGACCCTGAAAGAGCAG
gtaacggggctgtcacagggctgtggggtggcctgggatggggagcaggaggcaaaagcc
taggcgggggatgagcaagtggtagatggagggagatgagatgtagaggtggcaggaagt
gggcaaattgtgggtttaactctgaaggtaatagggagccatggagtgtgtgtgtgagca

 1.10 Intr +  15739  15976  238  0  1   61   51   233 0.464  14.62
gaatgcctgtctcacagcagctttgccagcattgaggtttattattcttttaatttttga
tgcatgttattggctgtggcctttgtccaagtctgtcttcataggctgtgccctgctgtc
tgcctatgggatgatgagtgtgatcaggtacccacaagctgtctttcatactcctgacag
CCAACCCAGCTGGAGCTTCCAGAAGGCTGTCAAGGGCTGGCGCCTGGCACGGAGGTCACT
TACCGACTACAGCTCCACATGCTGTCCTGCCCGTGTAAGGCCAAGGCCACCAGGACCCTG
CACCTGGGGAAGATGCCCTATCTCTCGGGTGCTGCCTACAACGTGGCTGTCATCTCCTCG
AACCAATTTGGTCCTGGCCTGAACCAGACGTGGCACATTCCTGCCGACACCCACACAG
gtgcctcctctgggtggggagggcggtatgagggcccctcagagctgagcacctactctg
agcctcagctagaccagggtgagaggagcgaggcagaaaattttaaaggagtgcctgatt
taggggtgtatcaaaaattcagtaatcagccaggcacggtggctcacacctgtaatccca

 1.11 Intr +  18375  18542  168  1  0  110   30    84 0.879   5.23
actttgtgcctggccccaaggcagcctccagtgcagggaaacagccaaacacagacaccc
ctggccctgtagggtcaggggtatagacgagagggtgggagagaggctgcaggagccaga
gaaggggactggggagagagatggcaactgtctcgatgcgtctctcccctctccttccag
AACCAGTGGCTCTGAATATCAGCGTCGGAACCAACGGGACCACCATGTATTGGCCAGCCC
GGGCTCAGAGCATGACGTATTGCATTGAATGGCAGCCTGTGGGCCAGGACGGGGGCCTTG
CCACCTGCAGCCTGACTGCGCCGCAAGACCCGGATCCGGCTGGAATGG
gtaatggcctggaatggcctgcgcctacccctcctctgtgccctcccttttaggtcctgg
tgggttcaaacctgcagggaaggcacacagcgggtgtctaaggcccagagaggtgttgct
gcttactcaatgtcatacagaggtagggacagggtgaggttcggagcctctcacccatat

 1.12 Intr +  19562  19699  138  0  0   79  115    99 0.970  12.64
gggatggggttgggggtgttgcatagggaagagatcttggaggaggggatattggtgcaa
gggctttgaaacatgagtaggagttttctgggggttcctggcagatggcacagccagtgc
aaaggtgcagaggtgggaacacaatctactgaatggcctggcctttgcttatccttccag
CAACCTACAGCTGGAGTCGAGAGTCTGGGGCAATGGGGCAGGAAAAGTGTTACTACATTA
CCATCTTTGCCTCTGCGCACCCCGAGAAGCTCACCTTGTGGTCTACGGTCCTGTCCACCT
ACCACTTTGGGGGCAATG
gtaagtgacccaaacctgcaggtttacattattttttctttttaaataatttaaaaaaat
agaggctgggcacagtgactcacgcatgtaatcccagcactttgggaggccaaggtgggt
ggatcacctgaggtcaggagtttgaaaccagcctggccaatgtggcgaaaccctgtctct

 1.13 Intr +  21391  21546  156  2  0   46   98   145 0.942  11.79
tttttgtatttttagtagagaaggggttttgccatgttggccaggctggtcttgaactcc
tggcctcaaatgacttacccacctcggcctcccaaagtgctgggattacaggtgcgagcc
actgtgccaggcctcgaccagcattcttggtgttgactatgacaatggtactggttgcag
CCTCAGCAGCTGGGACACCGCACCACGTCTCGGTGAAGAATCATAGCTTGGACTCTGTGT
CTGTGGACTGGGCACCATCCCTGCTGAGCACCTGTCCCGGCGTCCTAAAGGAGTATGTTG
TCCGCTGCCGAGATGAAGACAGCAAACAGGTGTCAG
gtacgtgaggcagtgcagacctggcttggggaggaagggaggatcctggcctgtgatctc
tcttgctgtgtgaccctgggcaccttgccgtccttctctgggccttggttatcaaaccct
taaaacaagagaattggctgggcgcagtggctcacgcctgtaatcccagcactttgggag

 1.14 Intr +  24078  24212  135  1  0   74  109   160 0.996  17.75
tccagcctgggcgacagagcaagactccgtctcaaaaaaaaaaaaaaaaaaagaaagaaa
gagtagagattttagcaaaatgcctatgaatccccaccccacccacaggctgtggtagcc
cagcctggcctctgaggagtaaagaggtcccaggactcagggttgcctctcccactgcag
AGCATCCCGTGCAGCCCACAGAGACCCAAGTTACCCTCAGTGGCCTGCGGGCTGGTGTAG
CCTACACGGTGCAGGTGCGAGCAGACACAGCGTGGCTGAGGGGTGTCTGGAGCCAGCCCC
AGCGCTTCAGCATCG
gtgagtggagggggtaggacccagttatttacccagcatgcactgcactgcgcttcccac
aatgatcttagcagccctgccctcactctcactccctctatggctccctactgccctcag
gagaaagtagcagctcaaactgctcccattgccttctctcgcagcttcctctcacactcc

 1.15 Intr +  25811  25907   97  0  1   67   93   111 0.993   9.07
ccaggcctttatttcttgacagctaccgggcaggtgggttctgtggtctcccagtgagaa
gcccgtggcatgtgcaccaggatcagcagcaagttcatggagaaaccaggccctcctagc
tccttccctgaggaagaggcaggaggtagccctctgccaacccacgctctcccacctcag
AAGTGCAGGTTTCTGATTGGCTCATCTTCTTCGCCTCCCTGGGGAGCTTCCTGAGCATCC
TTCTCGTGGGCGTCCTTGGCTACCTTGGCCTGAACAG
gtaactgacacctcttaccgttaccatagcgatggtaatgatgctgggcaggggagccct
aaagtggagcttagcccgcagattgggtccttggctttgcccaggaaataattcaagggc
aagccagaggtagaagaaaacagctttattgaagcagcagttatagctccgtgactgcct

 1.16 Intr +  26891  26966   76  2  1  145   94    43 0.999  10.61
acgtttgtaatctcagctactcaggaggctgagtcaggagaatcgattgaacccaggagg
cagaggttgcagtgagccgagatcgcgccactgcactccagcctgggcaacagagcaaga
ctccgtctccaaaaaaaaaaaaaacctcagctcctctcactggtcccctttcctccccag
GGCCGCACGGCACCTGTGCCCGCCGCTGCCCACACCCTGTGCCAGCTCCGCCATTGAGTT
CCCTGGAGGGAAGGAG
gtaaggatgccttttctaattccaagtctttttattgggtgcacatgctggacaagggtt
acgcattagctcattttattctctcccaattcatcaaggtaaggactccaaaaccagtgc
tccataccccttcccattttaaagacaggcaggcagaggtccatttcctggcactagaaa

 1.17 Intr +  28003  28181  179  0  2   97   56   221 0.665  19.03
ctcaagtgatccacccgcctcagcctcccaaagtgctgggatgacaggtgtgagccactg
cacccgtccaggtctcaggatgttagagaatttaaccagcagtgacctggtccgttccat
cctgctgtggatgggaagtagagctctgctcacagctgtggccctaccctccctctgcag
ACTTGGCAGTGGATCAACCCAGTGGACTTCCAGGAAGAGGCATCCCTGCAGGAGGCCCTG
GTGGTAGAGATGTCCTGGGACAAAGGCGAGAGGACTGAGCCTCTCGAGAAGACAGAGCTA
CCTGAGGGTGCCCCTGAGCTGGCCCTGGATACAGAGTTGTCCTTGGAGGATGGAGACAG
gtgcaaggccaaggtcctggggcccagtgggccagacggtcaggggtgcaaccctgcccg
gggggtgggggggctagacatccatcgctcctgggatatcagggcctggaggcctgaggg
agaaacgaaaacatccactttgtcttacagacacgaagagcgactatctcaatcacaacg

 1.18 Term +  29146  29209   64  1  1   98   38    83 0.793   1.95
ggggtggtgataatgaccttacacagctgttcaaaatcatcgtaaatgagcctcctcttg
ggtatttttttcctgtttgaagcttgaatgtcctgctcaaaatctcaaaacacgagcctt
ggaattcattcattcattcattcattcattccacatatatttattaatctcttcctctag
GTCTCCTCCAGGAGCACCTAATCCGGGGGAGACAGAGCCGGATGAGAGCTTGGAACCCTA
CTAA
gttaggactgagcaggggaagggacggcctagggggagtggagcagccgggcactccggt
aacaggaaccgtggtttgcccccacgctccttcctcctcacgcccaccaactcgcagcag
gacccttgccccccttacacaccctgaatcctccctctttctgcccacactgccccacct

Predicted peptide sequence(s):


>IL12RB1_1|GENSCAN_predicted_peptide_1|790_aa
MARLFSLLSFNVFRSGDGVAEPRRWQRGSPGAVGLYVDPMEPLVTWVVPLLFLFLLSRQG
VQGQECHYVFIAFAAACRTSECCFQDPPYPDADSGSLPGSASGPRDLRCYRISSDRYECS
WQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQT
EKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKL
GDCGPQDDDTGENNNSNDNNSCSKLALIEHLLYARSNAEFFCMPLTLPHSSVLDSFQIAE
SCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPVGLVLIAENPPQPQVRFSVEQ
LGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMP
YLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTY
CIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKL
TLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRD
EDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWL
IFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDF
QEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRSPPGAPNPGE
TEPDESLEPY