GENSCAN 1.0	Date run: 15-Jan-104	Time: 19:55:26

Sequence ICAM4_1 : 3918 bp : 57.58% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1210   1633  424  0  1   71   60   393 0.530  29.58
cctggaatcttattcttgacctggggagcggaatccctttttgcagtactcccgggccct
ctgttggggcctccccttcctctccagggtggagtcgaggaggcggggctgcgggcctcc
ttatctctagagccggccctggctctctggcgcggggccccttagtccgggctttttgcc
ATGGGGTCTCTGTTCCCTCTGTCGCTGCTGTTTTTTTTGGCGGCCGCCTACCCGGGAGTT
GGGAGCGCGCTGGGACGCCGGACTAAGCGGGCGCAAAGCCCCAAGGGTAGCCCTCTCGCG
CCCTCCGGGACCTCAGTGCCCTTCTGGGTGCGCATGAGCCCGGAGTTCGTGGCTGTGCAG
CCGGGGAAGTCAGTGCAGCTCAATTGCAGCAACAGCTGTCCCCAGCCGCAGAATTCCAGC
CTCCGCACCCCGCTGCGGCAAGGCAAGACGCTCAGAGGGCCGGGTTGGGTGTCTTACCAG
CTGCTCGACGTGAGGGCCTGGAGCTCCCTCGCGCACTGCCTCGTGACCTGCGCAGGAAAA
ACACGCTGGGCCACCTCCAGGATCACCGCCTACAGTGAGGGACAGGGGCTCGGTCCCGGC
TGGG
gtgaggggagggggctggaagaggtgggggaagggtagttgacagtcgctctatagggag
cgcccgcggacctcactcagaggctcccccttgccttagaaccgccccacagcgtgattt
tggagcctccggtcttaaagggcaggaaatacactttgcgctgccacgtgacgcaggtgt

 1.02 Intr +   1733   2035  303  0  0   70   85   432 0.979  38.93
tgacctgcgcaggaaaaacacgctgggccacctccaggatcaccgcctacagtgagggac
aggggctcggtcccggctggggtgaggggagggggctggaagaggtgggggaagggtagt
tgacagtcgctctatagggagcgcccgcggacctcactcagaggctcccccttgccttag
AACCGCCCCACAGCGTGATTTTGGAGCCTCCGGTCTTAAAGGGCAGGAAATACACTTTGC
GCTGCCACGTGACGCAGGTGTTCCCGGTGGGCTACTTGGTGGTGACCCTGAGGCATGGAA
GCCGGGTCATCTATTCCGAAAGCCTGGAGCGCTTCACCGGCCTGGATCTGGCCAACGTGA
CCTTGACCTACGAGTTTGCTGCTGGACCCCGCGACTTCTGGCAGCCCGTGATCTGCCACG
CGCGCCTCAATCTCGACGGCCTGGTGGTCCGCAACAGCTCGGCACCCATTACACTGATGC
TCG
gtgaggcacccctgtaaccctggggactaggaggaagggggcagagagagttatgacccc
gagagggcgcacagaccaagcgtgagctccacgcgggtcgacagacctccctgtgttccg
ttcctaattctcgccttctgctcccagcttggagccccgcgcccacagctttggcctccg

 1.03 Term +   2183   2301  119  0  2   96   43    54 0.940   1.33
gcaacagctcggcacccattacactgatgctcggtgaggcacccctgtaaccctggggac
taggaggaagggggcagagagagttatgaccccgagagggcgcacagaccaagcgtgagc
tccacgcgggtcgacagacctccctgtgttccgttcctaattctcgccttctgctcccag
CTTGGAGCCCCGCGCCCACAGCTTTGGCCTCCGGTTCCATCGCTGCCCTTGTAGGGATCC
TCCTCACTGTGGGCGCTGCGTACCTATGCAAGTGCCTAGCTATGAAGTCCCAGGCGTAA
agggggatgttctatgccggctgagcgagaaaaagaggaatatgaaacaatctggggaaa
tggccatacatggtggctgacgcctgtaatcccagcactttgggaggccgaggcaggaga
atcgcttgagcccaggagttcgagaccagcctggacaacatagtgagaccccgtctatgc

Predicted peptide sequence(s):


>ICAM4_1|GENSCAN_predicted_peptide_1|281_aa
MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQ
PGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGK
TRWATSRITAYSEGQGLGPGWEPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRH
GSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITL
MLAWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA