GENSCAN 1.0	Date run: 15-Jan-104	Time: 19:29:04

Sequence HMG20B_1 : 6959 bp : 62.57% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    369    477  109  0  1   64   78   123 0.986  10.35
ccctcccaggagccccgcttgtcccaccttccccggatactgaccccatcagaccctgcc
tcctcgggctcatgcactctcgctgcagccccgccgtcgggggtcaaaacgccctggggt
gggcttttgggggaggggagattcttgggacggggctgaccgcggtatccttggctccag
GCCGGCGGGCGGCAAGGCTCCGGGCCAGCATGGGGGCTTCGTGGTGACTGTCAAGCAAGA
GCGCGGCGAGGGTCCACGCGCGGGCGAGAAGGGGTCCCACGAGGAGGAG
gtgagagtccctgcgctgagctgggggaggccccgggctcccgccccagcctcgaagccc
cgccccaggctggatttgaattgcttgtggctccgcccacagcccattttcctctggaag
ctgagaccccgccccgtgccagctgccacgcccctgacaggtcctctgccactctaagtc

 1.02 Intr +   1060   1263  204  0  0   45   80   429 0.864  38.41
cctctaacccaccgtgtcccgactgctgaccgggccctacctccatcttttccgggttct
tcctcccagctaggccccgcccccatccccgcccatacgcgttaggccccgcccatgccc
ctctgagccctgccccagtacgccaggcccccctcccaacgacgcagcccggttctgcag
CCGGTGAAGAAACGCGGCTGGCCCAAGGGCAAGAAGCGGAAGAAGATTCTGCCGAATGGG
CCCAAGGCACCGGTCACGGGCTACGTGCGCTTCCTGAACGAGCGGCGCGAGCAGATCCGC
ACGCGCCACCCGGATCTGCCCTTTCCCGAGATCACCAAGATGCTGGGCGCCGAGTGGAGC
AAGCTGCAGCCAACGGAAAAGCAG
gtgggcggggcggggcgccgagcagggctggcggggtccacggactaccccccagtagcc
ccgacccccaaaggattccacgtgcagggtttttccttcttcctggagaaatgcccaccc
ataaccaactttttttttttttttttttgtgagatggagtcttgctctgttgcccaggct

 1.03 Intr +   2217   2337  121  2  1   89   81   289 0.914  29.54
aggtgggagctcggaggtccctgagcaacaggctgaggagccggttctgtctgcctggag
ggaatagggagctatagaaggttcaggagaggggagggtgctgtgaaagcagagtgataa
agactggatcctggcgttggaggcttcccctgcttcaagccttctggtgctgccccccag
CGGTACCTGGATGAGGCCGAGAGAGAGAAGCAGCAGTACATGAAGGAGCTGCGGGCGTAC
CAGCAGTCTGAAGCCTATAAGATGTGCACGGAGAAGATCCAGGAGAAGAAGATCAAGAAA
G
gtgggaggggtcgggcgcggtggctcacgcctgtcatcccagcactttgggaggccgagg
cgggtgtatcacctgaggtcagaccagcctggccaacatagtgaaaccctccccctctac
taaaaatacaaaaattacctgggcgtggtggcgggtgcctgtaatcccagctactcggga

 1.04 Intr +   2938   2984   47  2  2  108  121    35 0.998   8.06
gggaaagatacatagccagacaggagtgaagggggctcactcggtacagcgatgggggat
gcccagacgcggggcactcaagtggggagctggagccggctgagcagcgctgacctaggg
tgcagggcgtggtccctggaggcctgggaggctgaccctgcccttcccctcccccgccag
AAGACTCGAGCTCTGGGCTCATGAACACTCTCCTGAATGGACACAAG
gtaagcgaccttcttcctctcaaagcacctgggggagaaaggtctggaggcttctagaac
cctgagtcagagccagtgctcgcccagatgtgtgcaagcaggggcggtgccactgcaccg
tgggatcgctgttgattgtactcccaccggggtgtcccaggagaccctcctaggcttggg

 1.05 Intr +   3230   3302   73  1  1   79  105   144 0.999  15.33
gtcagagccagtgctcgcccagatgtgtgcaagcaggggcggtgccactgcaccgtggga
tcgctgttgattgtactcccaccggggtgtcccaggagaccctcctaggcttggggcaca
cccagagagcgtggctgcctcctaccaccagtaaattgccaccttgtcccttcgtcttag
GGTGGGGACTGCGATGGCTTCTCCACCTTCGATGTTCCCATCTTCACTGAAGAGTTCTTG
GACCAAAACAAAG
gtgagcggtaactgcgctcctgatgcgaactccgtgaaactgggtggtagaggggggcgt
gggccaggagggccccaagactgcaggaggcggatcgggaggttccctatgagcgtccag
gcgcacgctgtcgctccagaggctgatgtggagcaggaggcagagggcgcagtgagggaa

 1.06 Intr +   3569   3784  216  0  0   68   49   456 0.999  39.40
gaggcggatcgggaggttccctatgagcgtccaggcgcacgctgtcgctccagaggctga
tgtggagcaggaggcagagggcgcagtgagggaaacctgggcaggggcacgtcccgggca
aaagcccggaggtaggggaaaggggaggcgcaggctttgaccccgctccccccggcgcag
CGCGTGAGGCGGAGCTTCGGCGCTTGCGGAAGATGAATGTGGCCTTCGAGGAGCAGAACG
CGGTACTGCAGAGGCACACGCAGAGCATGAGCAGCGCGCGCGAGCGTCTGGAGCAGGAGC
TGGCGCTGGAGGAGCGGAGGACGCTGGCGCTGCAGCAGCAGCTCCAGGCCGTGCGCCAGG
CGCTCACCGCCAGCTTCGCCTCACTGCCGGTGCCGG
gtgcgggccacgcccatctcccagtcccgccccggtcacccggccccgcccgcctccccc
cccctcctcccttccccccttcccctgtcgcccggcgccgcccatcgccccgtcccctct
tccccagtcacccggccccgcctatcgccccgccctcatcacccccagctccgcctcctc

 1.07 Intr +   4658   4790  133  0  1  127   89   278 0.999  32.68
tcctcgccatcctcctgccccggcttaccttagcccaccctgcgccgctcctgcgctggc
ggtgtccggacctctgagcgcccgcgcgacccgccctgagtcaccccctaccgctgcccc
tggagcccccgccccgcgactccccggcaccctcgcctgaccttcccgcctgtcccccag
GCACGGGCGAAACGCCCACGCTGGGCACTCTGGACTTCTACATGGCCCGGCTTCACGGAG
CCATCGAGCGCGACCCCGCCCAGCACGAGAAGCTCATCGTCCGCATCAAGGAAATCCTGG
CCCAGGTCGCCAG
gtgtgtgccgggcgaggcggggcggggccggggttcaaggcccggatgtgcccgccctgg
ggttccccaggtccgcgagggctgctgggtgggactccgcagcttactagagatcacctc
ccggaggggcctacctgcggtcgcccctgatgcaccagtgctaggatggccatggagaac

 1.08 Term +   5379   5574  196  0  1   73   47   129 0.895   5.15
ggagtgggcgggcccacgatgcagaggagaagctgtgggcgcggccctgccacaccccac
cccgtggacgagaggctgggggtccaccctttggggcctggtcccatcctgcaccttggg
ggctccagcccccctaaaattaaatttctgcagcatccctttagctttcaatctccccag
CCCCCTGAACCCGGAAAAAGCACTCGCTGCGCGATACACCCAGAAGAACCTCACAGCCGA
GGGTGCCCCTCCTCGGAGGACAGCCACGCGCTACACTGGCTCTCCGGGCCACCCCCAGGA
CACAGGGCAGACGAAACCCACCCCCAGCACACGGCAGGACCCCCCAAATTACTCACTACG
GGGGGCTGTGCCATAG
gccacacaggaagctgccttgtggggacttacctggggtgtcccccgcatgcctgtaccc
cagatgggtgggggccggctttgcccatcctgctctcctccagccgagggaccctggtgg
gggtggctccttctcactgctggatccggactttttaaataaaaacaagtaaaatttgtg

Predicted peptide sequence(s):


>HMG20B_1|GENSCAN_predicted_peptide_1|366_aa
XPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKA
PVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMK
ELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVPIFTEEF
LDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQQL
QAVRQALTASFASLPVPGTGETPTLGTLDFYMARLHGAIERDPAQHEKLIVRIKEILAQV
ASPLNPEKALAARYTQKNLTAEGAPPRRTATRYTGSPGHPQDTGQTKPTPSTRQDPPNYS
LRGAVP