GENSCAN 1.0	Date run: 15-Jan-104	Time: 19:29:09

Sequence GIPC3_1 : 7265 bp : 57.10% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1228   1452  225  0  0  110   94   447 0.515  44.14
gggcccgacccacccctgcgcaccccgcggtgtcgccttcccgggaggctcgggttccca
gatccccttacccgggcgtctcggctgtcgcgccctgggccgggggaggggaggctgcag
gaagcggcggatccggcggcggcggcgagggcccgggtgggtggccgaacttctcccgcc
ATGGAGGGAGCAGCGGCCCGGGAGGCCCGGGGGACCGAGACCCCGCGCGCGTCTGCGCCC
CCGCCCGCGCCCTCGGAGCCCCCGGCCGCGCCCCGCGCCCGCCCGCGCCTCGTCTTCCGC
ACGCAGCTGGCGCACGGGAGCCCCACGGGCAAGATCGAGGGCTTCACCAACGTCCGCGAG
CTGTACGCCAAGATCGCCGAAGCCTTCGGGATCGCGCCCACCGAG
gtaaggagcccggacaccggcgcccaagaccacccgcctgatggggtgaggggtagggag
cttggaccctggacgggagaccccagatccccggatcccagacgtcggggtggccgccta
atcgccggatctcagagacccagccctcagatcccggggtgccacactcccaggggcccc

 1.02 Intr +   2125   2310  186  0  0   37   44   333 0.887  24.89
ggggtctccacctgctggaagtctccttctccctcctctctctgttctgggggtcccacg
ccctgccctttcccatgggctgggatcctggtcgctgggggcaggggcctgcgcagacag
ggtggctgcgtggggggatgcatgccctggctaactctaggctccttctcccccgggaag
ATTTTATTCTGCACCCTCAACAGCCACAAAGTGGACATGCAGAAGCTCCTGGGGGGTCAG
ATAGGCCTGGAGGACTTCATCTTTGCCCACGTGCGAGGCGAGACCAAGGAGGTGGAGGTC
ACTAAGACAGAGGATGCTCTGGGGCTGACCATCACGGACAACGGGGCTGGCTACGCCTTC
ATCAAG
gtgcccgggagggggtgggcgggtggcttcctggggtccagcaactgccccccccactct
gggtcgacgtgggttctgcggattggaggcgggtggctggggttgccctgccagcgacgc
tggatccctgcagagaatcaaggaaggcagtatcatcaaccggatcgaggcagtgtgcgt

 1.03 Intr +   2444   2624  181  1  1   57   85   423 0.685  39.54
tggggctgaccatcacggacaacggggctggctacgccttcatcaaggtgcccgggaggg
ggtgggcgggtggcttcctggggtccagcaactgccccccccactctgggtcgacgtggg
ttctgcggattggaggcgggtggctggggttgccctgccagcgacgctggatccctgcag
AGAATCAAGGAAGGCAGTATCATCAACCGGATCGAGGCAGTGTGCGTGGGTGACAGCATC
GAAGCCATCAACGACCACTCCATTGTGGGCTGCCGCCACTACGAGGTGGCCAAGATGCTC
CGGGAGCTGCCCAAGTCCCAGCCCTTCACCCTGCGCCTGGTGCAGCCCAAGAGGGCCTTC
G
gtgaggcgggtgggctggcgggagctcttcccgaagtgcgttctacggatgcctggggtg
gaggagggtcggggatgggacgggctggaaggttctaggtgcacccgctgcgtgccaagg
agctcctggcagggtatcagaaactcgtaggtagtttctattaatagattgttatggagt

 1.04 Intr +   5073   5257  185  1  2  101   86   119 0.755  13.71
tttgctggggatgcgaagtgtggaatctcgaataggtctctggagacttgccgtacagat
gtaaggaggactttgaaggggaggaagattctagaaaggctcggctgttggcctcccagg
gtttacaaagatgtggctccacccagaacccatggccatccctcactctgttccctccag
ATATGATTGGCCAGAGAAGTCGGTCCAGCAAATGTCCAGTAGAGGCGAAAGTGACCAGCG
GGAGGGAGACCCTGCGGCTTCGTTCTGGGGGGGCTGCCACAGTGGAGGAAGCGGTGAGTG
AAGGGGAGGGGCTCTCCCCAGGCTTCTGCACCTTCAGCTCCTCCACTGAGTCAGTGCGGT
CTTGG
gtaagaacttctcctcggagcctcagtttctctgcctgcaaaatgggtcctcattgaaaa
gtggggcaatgatgttggtaccagcactactgactcgtgtgagggtccagtctactcttc
ccttaggggtgggggtcgggagggggctgggctggagggctccaaagcttttcacccctg

 1.05 Intr +   5461   5542   82  0  1  103   82   157 0.999  16.97
cagtttctctgcctgcaaaatgggtcctcattgaaaagtggggcaatgatgttggtacca
gcactactgactcgtgtgagggtccagtctactcttcccttaggggtgggggtcgggagg
gggctgggctggagggctccaaagcttttcacccctgacttccctcccgtgtgcccccag
CCCAGTGAGTTTGAGGAGGAGGCATCTCGGAAGGTTGATGACCTGCTGGAAAGCTACATG
GGCATTCGGGACCCCGAGCTGG
gtaaggggccagggtaagccagggggccctggggggagggaagcctacgggaggaggcag
gggtcccagcgggaagttgggcgcggggagtgccctcactgacatcccctctggcacggc
ccgcagcgtccaccatggtggagacgtccaagaagacagcgagcgcccaggagtttgcac

 1.06 Term +   5669   5820  152  0  2   78   29   248 0.980  16.92
ggaaggttgatgacctgctggaaagctacatgggcattcgggaccccgagctgggtaagg
ggccagggtaagccagggggccctggggggagggaagcctacgggaggaggcaggggtcc
cagcgggaagttgggcgcggggagtgccctcactgacatcccctctggcacggcccgcag
CGTCCACCATGGTGGAGACGTCCAAGAAGACAGCGAGCGCCCAGGAGTTTGCACGCTGTT
TAGACTCCGTCTTGGGCGAGTTCGCCTTCCCCGACGAGTTTGTGGTGGAAGTGTGGGCCG
CCATCGGCGAGGCCAGAGAGGCCTGTGGCTAG
tttgccctgggggggcccagcacagccccagcccggagcccagccccctgccccggccct
gctccagaacccagcccagatcggaggacaagttcctctctagaacccaatccaatttgg
agccccagcccaactccagaacccaacccttctctagaatccagcccagatctgaggcca

 2.01 Init +   6252   7154  903  2  0   91   47   310 0.445  21.94
caggccagccctgagaccaagcccagctctagaactcagatgagctttgagaccatgccc
agcactgagaccaagccctgttctagaactcaggcctgctctgaggccaagcccagctct
agaacccagatgagctctgagaccatgcccagctctagaactcagatgggctctgagacc
ATGCCCAGCTCTAGAACTCAGATGGGCTCTGAGACCGAGCCCAGCTCTAGAACTCAGATG
GGCTCTGAGACCGAGCCCAGCTCTAAAACTCAGATGGGCTCTGAGACCATGCCCAGCTCT
AGAACTCAGATGGGCTCTGAGACCGAGCCCAGCTCTAGAACTCAGATGGGCTCTGAGACC
GAGCCCAGCTCTAGAACTCAGATGGGCTCTGAGACCATGCCCAGCTCTAGAACTCAGATG
GGCTCCGAGACCAAGCCCAGCTCTAGAACCCAGATGAGCTCTGAGACCATGCCCAGCTCT
AGAACTCAGATGAGCTCTGAGACAGAGCCCAGTATTGAGACCAAGCCCTGTTCTAGAGTC
CAGGCCAGCTCCGAGACCAAGCCCAGCTCTAGAACCCAGATAAGCTCTGAAACCAAGCCC
AGCATAGAGACCAAGCCGTGTTCTAGAATTCAGGCCACATCTGAAGCCAAGCCCAGCTCT
AGAACTCAGGTCAGCCCTGAGACCAAGCCCAGCTCTAGAACCCAGATAAGCTCTGAAACC
AATCCCAGCATTGAGACCAAGCCCTGTTCTAGAACTCAGGCCACCTCTGAGGCCAAACCC
AGCTCTAGAACCCAGATAAGATCTGAGACCAAGCCCTGCTCTGAAGCCCAGGCCAGCTCT
GAGACGAAGCACATCTCTAGAATCCAGCTGAGCCCTGACAACAAGCCAAACTCTGGAACC
CAGACACATTTTAAGACCCAGACCAGCTTGGAGACCAATCCCAGTTCCAGAATCCAGGCT
AGCTCGGAGACCAAGCCCTGCTGGAAAACTCAAGCTGACTCTGGAACTCTGGACAGCTCC
ACGATGCAGCCACACCTGGACACTCGGTCTAGCTCCGGAACCCCAGTTAATTTTGGAACC
CAT
gtgagattcatgaagcagcccagctctggaaccccagtcagctcaggattcagagacagc
tcccaaatcaaatcctattcaagaactcagaccagctcagaaacccaggtcg
Predicted peptide sequence(s):


>GIPC3_1|GENSCAN_predicted_peptide_1|336_aa
MEGAAAREARGTETPRASAPPPAPSEPPAAPRARPRLVFRTQLAHGSPTGKIEGFTNVRE
LYAKIAEAFGIAPTEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTED
ALGLTITDNGAGYAFIKRIKEGSIINRIEAVCVGDSIEAINDHSIVGCRHYEVAKMLREL
PKSQPFTLRLVQPKRAFDMIGQRSRSSKCPVEAKVTSGRETLRLRSGGAATVEEAVSEGE
GLSPGFCTFSSSTESVRSWPSEFEEEASRKVDDLLESYMGIRDPELASTMVETSKKTASA
QEFARCLDSVLGEFAFPDEFVVEVWAAIGEAREACG

>GIPC3_1|GENSCAN_predicted_peptide_2|301_aa
MPSSRTQMGSETEPSSRTQMGSETEPSSKTQMGSETMPSSRTQMGSETEPSSRTQMGSET
EPSSRTQMGSETMPSSRTQMGSETKPSSRTQMSSETMPSSRTQMSSETEPSIETKPCSRV
QASSETKPSSRTQISSETKPSIETKPCSRIQATSEAKPSSRTQVSPETKPSSRTQISSET
NPSIETKPCSRTQATSEAKPSSRTQIRSETKPCSEAQASSETKHISRIQLSPDNKPNSGT
QTHFKTQTSLETNPSSRIQASSETKPCWKTQADSGTLDSSTMQPHLDTRSSSGTPVNFGT
H