GENSCAN 1.0	Date run: 15-Jan-104	Time: 18:40:37

Sequence FLT3LG_1 : 14218 bp : 54.47% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    335    409   75  1  0   72   80    79 0.604   4.57
ggcaggatccctgtgctcctccgagtggcacaggaaacttggctgatagaggcgctctct
ccatgcatcctccaccatccactccccggtcccttagacttccattcagaagtgacacct
gtcacctccaccctcatgtgactggccaaagtgagtgtggccatgtccgagttccccagg
ATGGGACCTCGAATCCTCCTGCTGGGGGGGTGGGGGCAGCAGATGTTTCAGGACAGTCTG
CCACGGATCAGATGG
gtgagcaagagattcaggatgggcgtgatgggtcacacctgtaatcccagcattttggga
ggccgaggcaggctgatcacctgaggtcaggagttcgagatcagcctggccaacatagtg
aaacctcgtctctactaaaaatacaaaaattagccgggcatggtggcacgcacctgcaat

 1.02 Intr +   2658   2768  111  2  0   76   93   145 0.999  14.88
cagagagaaaccgggaaagacaggcagagatggggccatgtctccagaaagtgtggaaga
ggcagaaggacacccagggaaggaggagcggggaagacagaacagtacaggtgggaagcc
cggaggagggggctgtgtgtggaacagcagagggctcccccagcacccgctcccctgcag
ACCTATCTCCTCCTGCTGCTGCTGCTGAGCTCGGGACTCAGTGGGACCCAGGACTGCTCC
TTCCAACACAGCCCCATCTCCTCCGACTTCGCTGTCAAAATCCGTGAGCTG
gtgagcggcgctgccccggaccccctcatgtgatcccccttccccccactttttttttta
agtagagatggggtctctctccctgtgtttcccagggtggtcttgaactcctgggctcaa
gcgatcctcccaccttggcctcccaaagtgctggaattacaggcgtgagccactgtgctt

 1.03 Intr +   3112   3165   54  0  0  114  105    90 0.999  12.96
cgtgagccactgtgcttaggggtgtcatccctttttaagggcaaggttctgtggcttctt
ctgggctccccctctcttggtcttgtccctctctctctggatctctgctgccacctctgg
gtccccacagttctgtttctcgctgttttcagccaggcctgatcctgttttctcccgcag
TCTGACTACCTGCTTCAAGATTACCCAGTCACCGTGGCCTCCAACCTGCAGGAC
gtaagtcatgttgggagggacctgggatggaggtggggaccacagactcaagatgctcca
ccgaggcgagtggataaccaggccctcccctccccaaacccaggaatcagagtcctcagc
ccctcctccctcagacccaggagccccggcccagcccctcctccctcagacccagcagcc

 1.04 Intr +   3390   3533  144  2  0  114   76   188 0.955  21.19
gactcaagatgctccaccgaggcgagtggataaccaggccctcccctccccaaacccagg
aatcagagtcctcagcccctcctccctcagacccaggagccccggcccagcccctcctcc
ctcagacccagcagccccgtgcccagctcctccctcagacccgtgggttctcccctctag
GAGGAGCTCTGCGGGGGCCTCTGGCGGCTGGTCCTGGCACAGCGCTGGATGGAGCGGCTC
AAGACTGTCGCTGGGTCCAAGATGCAAGGCTTGCTGGAGCGCGTGAACACGGAGATACAC
TTTGTCACCAAATGTGCCTTTCAG
gtcagccctcaacttaggggacaagtgaggggagggagatgccttcctacgaattagaag
taaagctccactaggccttattggcgatttggaccatagccacccaacgaaggtagagcg
agaagcgccaccctgcagagccctgttcctacagaacaacacgtccccaggcaccggtga

 1.05 Intr +   5876   6014  139  1  1   94   60   211 0.977  19.44
cctgggcaacagagtgagactctatctcaaaaaaaaattaattaattaaataaataaact
ctgagagccagagctcactgggccctgttgctgggcatcgccagcagggaagggcctttg
gcctgcggaggggcggtggggggatgacgtggtggtgacgtctccctcccctgctcccag
CCCCCCCCCAGCTGTCTTCGCTTCGTCCAGACCAACATCTCCCGCCTCCTGCAGGAGACC
TCCGAGCAGCTGGTGGCGCTGAAGCCCTGGATCACTCGCCAGAACTTCTCCCGGTGCCTG
GAGCTGCAGTGTCAGCCCG
gtaaaggcttccaggcacccccactccttcccctcctgtcctcacggccgctcctcctct
ctgcacagtgcatcccagaccccatctttctcatattggttgtgacaagggcaagcttat
tcctctttctggagctcagtttaccaattttttttttttttttttgagacggagtctcgc

 1.06 Intr +   7265   7443  179  0  2  121   99   133 0.949  17.86
atttgtgacagtctgatgaggtaggtacaatgattatcctagttttacagatgagcaaac
tgaggcacagagaggccaagcagcccatccaaggtcacacagccagtggcagccaggcct
ctctttccttccttaccccagcccttctccttggtcacccagcctcctctttctccccag
ACTCCTCAACCCTGCCACCCCCATGGAGTCCCCGGCCCCTGGAGGCCACAGCCCCGACAG
CCCCGCAGCCCCCTCTGCTCCTCCTACTGCTGCTGCCCGTGGGCCTCCTGCTGCTGGCCG
CTGCCTGGTGCCTGCACTGGCAGAGGACGCGGCGGAGGACACCCCGCCCTGGGGAGCAG
gtgagcaggctgggaagagggggtgagggggccgagagggtggcccacttgtggctgaca
ctttggggcccacaggtgccccccgtccccagtccccaggacctgctgcttgtggagcac
tgacctggccaaggcctcatcctggtgagtccttcctgggctatggggcctggactttgt

 1.07 Intr +  13099  13209  111  0  0  102   62     6 0.003   0.48
ctcctctctcagcggagccttaaacaacgcagtgagacagacatctatcatcccatttta
caggggaggatactgaggcacacagaggggagtcaccagccagaggatgcatagcctgga
cacagaggaagttggctagaggccggtcccttccttgggcccctctcattccctccccag
AATGGAGGCAACGCCAGAATCCAGCACCGGCCCCATTTACCCAACTCTGTACAAAGCCCT
TGTCCCCATGAAATTGTATATAAATCATCCTTTTCTACCAGCTCTGGCCAG
gtctgtctatggatgggtgtgaatggggtagttttgatttcagaatcttggtttttgaat
tgcaatgcaatgtttcattcaatacgtgttttctgaggtcccctggagccccgggccggc
gctgggcaatgtcagagcctggatttgagtcagaaccagcccaggtgccccaggtctcct

Predicted peptide sequence(s):


>FLT3LG_1|GENSCAN_predicted_peptide_1|271_aa
MGPRILLLGGWGQQMFQDSLPRIRWTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIR
ELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH
FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLP
PPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQNGGNAR
IQHRPHLPNSVQSPCPHEIVYKSSFSTSSGQ