GENSCAN 1.0	Date run: 15-Jan-104	Time: 20:35:12

Sequence FKBP8_1 : 12505 bp : 55.00% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1100   1391  292  1  1   84   82   398 0.509  34.11
ggggttgttgttacacccactgtatagatgaggaaactgaggcctggagcccttgagtta
cacagaaagtgatcggcagtgtggggaatcagtacagtggagactttgaggggctgtgta
ggattctgacccacatctctgccccccacttccagggccaattcctgtccccccagcagc
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCG
CTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAG
GAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATG
GAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGG
gtaaggagcaaaggtggatcagggtgcccttggccctggccctctcgtcccctgagcctc
atttccccatctgtgctgtgagggttggaagtcacgtggtcaccaccgtgatcaccagcc
agaggcaactactggagatgcttcacattgatgtactctatccactgactcacacacatg

 1.02 Intr +   3350   3519  170  0  2   52   80   251 0.999  20.88
cgtggggttccccactctggtggcagagtggccattggaagtttggtttgtgccccagtg
ttgggccagccccctctggacagctagtgggcagagctgagggtaggagtgggggctcag
gggagcgggtgcctgtttgagctgccaggtgacaggctgcatgtccctggaccctggcag
GGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGG
TCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGC
AGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAG
gtgcgggctggggcgggacagggcaggggcgaggggcgtgccttgctgggtctgagtctg
cctgacagctggctatccccacacaccccaggccctggatctcagtgtcccactcatgga
cgtgggggagacggccatggtcactgctgactccaagtactgctacggcccccaaggcag

 1.03 Intr +   3611   3699   89  1  2   64   94   157 0.999  13.17
tacatctgcagacgtcgctggagaatggcacacgggtgcaggaggagccggagctggtgt
tcactctgggtgactgtgacgtcatccaggtgcgggctggggcgggacagggcaggggcg
aggggcgtgccttgctgggtctgagtctgcctgacagctggctatccccacacaccccag
GCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGAC
TCCAAGTACTGCTACGGCCCCCAAGGCAG
gtgagagtcagccacccttaggtctctgcaggtctcaggagggggatgggtggagtgggt
gtacccctcggctcaccccatctacttgcccattttatagacaagaaactgaggctgggt
gaggtggctcacacctgaaatcccagcactttgggaggttgaggtaggaggattgcttga

 1.04 Intr +   4634   4866  233  2  2   44   32   564 0.400  44.35
aagtcccgcagctccaaggcggcaagtcacttcccctgcactttactgaggagggaatga
tggagggcagaggggagacagatcgggggcttgagccaagctcactccttcctagccagc
ccagcgggtttaggggtcaccaggtctgagtgctgcccctgcctgctcccacccaactag
CAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGC
TGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCG
GAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTC
CTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGGTGACCGCCTGG
gtcagatctccaccatctcccctgcaaaggtgtccactccgtgccagaaacttccagccc
cagagagcctcagactcagaatattctagaatagcccagaatatgggtagatccccaact
gcccctaagctagggcctgttacagactcgtggtatatcccagaccagtggagtgttgta

 1.05 Intr +   5297   5469  173  0  2   48  102   351 0.986  32.68
tcgcttgcttaagtctccatcttgtagcttcctcaggagagccccaggaaagcgtggccc
ttggtccggggttaaaattggggaaactgaggccagagaggcagcctccgcagaggggtg
ggtgccggggtgtctggtggcatggtgacggctgccgtggcgggcactgtctcccaatag
TGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAGTTGAAGGTGAAGTGTCTGAACA
ACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCC
TTGTGCTGGAGCACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAG
gtaggccacaccggggtgccaggccgggtcactcagcctggggtatacggggtggtcccc
aaccctgcatttgagaaaggcataggtatataagccagctgagctctgtggggtgcaggt
ggagaaactgaggcccagacgggtgcaggagtgtggcctggtcacaacaattcattggct

 1.06 Intr +   9723   9800   78  2  0  125  105   102 0.997  15.84
ttctccatgttggccaggctgtttttattttattttattttttgagatggagtcttgctc
tgttgctcaagctggagtgcagtgacaccatcttggctcactgcaacctcctgggctgga
tttcttgaaggacaggcccaggtatgggtccagagtgatgccacccccttccccttacag
GTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTGAGGGCAGCCCTGAAG
CTGGAACCTTCCAACAAG
gtgagcaggacaggggtgccctgggacttgctcggctgggaagtccctcctgcggtctgc
cccaggtctttcttgctgtggctctctgttgtgttcccacctgggcagtggcacggagta
ggtacctgaagggtcctggtcagcttgtgaagaccctcatgacggccacacaggcagtct

 1.07 Intr +  10275  10406  132  2  0   88   80   184 0.998  18.95
ttggctccctaggagggatggggtcagcagccctgactttgctaagcccagaaaggggca
gatgggacccctgtgtcccaacagtcccaccacccaaacagcctagggtcccagtaaggc
agagcgccagtgatgacaggttggccgctgcgtgttctcagcttcccctgccttctgcag
ACGATCCACGCAGAGCTCTCAAAGCTGGTGAAGAAGCATGCGGCGCAGCGGAGCACGGAG
ACCGCCTTGTACCGGAAAATGCTGGGCAACCCCAGCCGGCTGCCTGCTAAGTGCCCTGGC
AAGGGTGCCTGG
gtgagctggggcacagaatgggcaggggctgtgtgcagggcacgcctagcagagggattt
tattttgcatacatggatgtcctcggagactgggccgtcctgggcgatgcaggggacgtg
gagagagcccagccctgtgtgatcatgagtggagtcgaaggtggaactcaagctggaggg

 1.08 Term +  10815  10901   87  2  0  113   47    37 0.977   0.06
tggaggaggggccatttgatttgggttttgctgcatgagtaggagtttgccaggaagtgg
gaaatacatagtcaggcaatgatttgttgggaggtctgtttgggctgtgctggcagctga
ggccccagaggccagtcttgacctccctccacccttctctcccctcctttttatccacag
TCCATCCCATGGAAGTGGCTGTTTGGGGCGACTGCTGTTGCCTTGGGGGGTGTGGCACTC
TCTGTGGTCATCGCTGCCAGGAACTGA
ccacctaggtggctgccaccccctctgcacaccatggaccctgccctgcgctccccaact
cccccaggctccctgtccactgccctccctggtctggccccctcctccgggttaggggag
caaggattgggggtcgtgcagcccagccagcaggagggactgaggccctctaggaggaaa

Predicted peptide sequence(s):


>FKBP8_1|GENSCAN_predicted_peptide_1|417_aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQ
PPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKG
QVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVL
AANSYDLAIKAITSSAKGDRLVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSC
SLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAA
QRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN